PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016492351.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 646aa    MW: 71891.2 Da    PI: 8.1131
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016492351.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.92e-093924291954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  XP_016492351.1 392 FEHflHPYPKDSDKIMLAKQTGLTRSQVSNWFINARVR 429
                     554459******************************88 PP

2BELL119.71.3e-38255326172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +rqe q+kkakL+++leeV++rY+qy++q+q+++ssFe+vag+gsak+Yt+lAl+aiS++FrcLkdai++qi
  XP_016492351.1 255 QRQEFQMKKAKLVTMLEEVEQRYRQYHHQMQIIVSSFEQVAGIGSAKSYTQLALHAISKQFRCLKDAIVGQI 326
                     699********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.2E-60179324IPR006563POX domain
PfamPF075267.5E-48184323IPR006563POX domain
PROSITE profilePS5007112.05370433IPR001356Homeobox domain
CDDcd000868.28E-12373434No hitNo description
SMARTSM003894.2E-10373437IPR001356Homeobox domain
SuperFamilySSF466894.28E-17374440IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.4E-29376439IPR009057Homeodomain-like
PfamPF059202.5E-18390429IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 646 aa     Download sequence    Send to blast
MYYQGTSDNI HQAADGNIQT LYLMNPNYIH QGYSNDTQQQ QHQHQHHQQQ IIRHAPLQQA  60
QQHFVGVPLP AVSLHDQNHA QLIHRLWNQS GGGGGNGSHH QSQIIPSSTV VSATSCGGST  120
TDLASQLGFQ RPIIMSPTQQ QQQQQGGLSL SLSPQQQQIS FNNISAQNQV GSNINRGLDG  180
ISSMVLGSKY LKAAQELLDE VVNVGKCIKG SELEKGELMN KESILPLASD VNTSNSGGES  240
SSKQKNGVAE LTTAQRQEFQ MKKAKLVTML EEVEQRYRQY HHQMQIIVSS FEQVAGIGSA  300
KSYTQLALHA ISKQFRCLKD AIVGQIKATS KSLGEEDQSL GEKIEGSRLK FVDHHLRQQR  360
ALQQLGMMQP NAWRPQRGLP ERAVSVLRAW LFEHFLHPYP KDSDKIMLAK QTGLTRSQVS  420
NWFINARVRL WKPMVEEMYL EEMKNNQEQN SSSEENKNKN ESNKEKMVSK SSAPQESGTP  480
TEIATSTIST PPTACGSSFQ AAQAHNFSFL GSLNMENNTT TKKPRNHDMH NNSPSNILSS  540
VDMAETKARD HQSKKGFNPL MDAAAVYTMG EFGRFNPHEQ MAATNFHGNN GVSLTLGLPP  600
NSENLSQQSY QNTIEFNRMS YENIDFQNKR FPSQILPDFV AGNLGT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-16379437563Homeobox protein Meis2
3k2a_B4e-16379437563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6863800.0EU686380.1 Solanum palustre BEL5 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016492351.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016492350.10.0PREDICTED: BEL1-like homeodomain protein 1
TrEMBLQ7Y0Z70.0Q7Y0Z7_SOLLC; Bell-like homeodomain protein 2
STRINGSolyc06g074120.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-104BEL1-like homeodomain 1