PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016492117.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MIKC_MADS
Protein Properties Length: 252aa    MW: 29093 Da    PI: 9.8989
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016492117.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.91.3e-28959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krienk+ rqvtfskRr g+lKK +E+SvLCda+va+i+fs +gklyeys+
  XP_016492117.1  9 KRIENKISRQVTFSKRRSGLLKKTHEISVLCDADVALIVFSAKGKLYEYST 59
                    79***********************************************96 PP

2K-box965.8e-3276173299
           K-box   2 qkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                     ++++ ++++++  e+++ e+ kL ++ie Lqr++Rh++GedL+s  l+e + LeqqL+++lk+iR++Kn+l++e+i++lqkkekelqe+n+ ++k
  XP_016492117.1  76 AERKLNANDSEPKENWTLEYPKLMSRIELLQRNIRHYMGEDLDSFGLREFHGLEQQLDTALKRIRTRKNQLMHESISQLQKKEKELQEQNHLMSK 170
                     5566777888889*******************************************************************************999 PP

           K-box  97 kle 99 
                     kl+
  XP_016492117.1 171 KLK 173
                     986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.9E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.651161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.84E-33292IPR002100Transcription factor, MADS-box
CDDcd002651.69E-41276No hitNo description
PRINTSPR004041.3E-29323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.8E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-293859IPR002100Transcription factor, MADS-box
PfamPF014863.4E-2785172IPR002487Transcription factor, K-box
PROSITE profilePS5129716.0888178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MGRGRVEMKR IENKISRQVT FSKRRSGLLK KTHEISVLCD ADVALIVFSA KGKLYEYSTE  60
SSMESILERY ESYSYAERKL NANDSEPKEN WTLEYPKLMS RIELLQRNIR HYMGEDLDSF  120
GLREFHGLEQ QLDTALKRIR TRKNQLMHES ISQLQKKEKE LQEQNHLMSK KLKGNEKQQT  180
EDAQWGKPNP GQSSTPFILP QIPSQSPPHV PNLTIGGPFQ STGFTSTDEG QTRHGSNSLI  240
PPWMLHHLRN KG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-18174173Myocyte-specific enhancer factor 2B
1tqe_R1e-18174173Myocyte-specific enhancer factor 2B
1tqe_Q1e-18174173Myocyte-specific enhancer factor 2B
1tqe_P1e-18174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009616788.10.0PREDICTED: truncated transcription factor CAULIFLOWER A-like
RefseqXP_009616789.10.0PREDICTED: truncated transcription factor CAULIFLOWER A-like
RefseqXP_009616790.10.0PREDICTED: truncated transcription factor CAULIFLOWER A-like
RefseqXP_009616791.10.0PREDICTED: truncated transcription factor CAULIFLOWER A-like
RefseqXP_009616792.10.0PREDICTED: truncated transcription factor CAULIFLOWER A-like
RefseqXP_009616793.10.0PREDICTED: truncated transcription factor CAULIFLOWER A-like
RefseqXP_016492111.10.0PREDICTED: agamous-like MADS-box protein AGL8 homolog isoform X1
RefseqXP_016492112.10.0PREDICTED: truncated transcription factor CAULIFLOWER A-like isoform X2
RefseqXP_016492113.10.0PREDICTED: truncated transcription factor CAULIFLOWER A-like isoform X2
RefseqXP_016492114.10.0PREDICTED: truncated transcription factor CAULIFLOWER A-like isoform X2
RefseqXP_016492115.10.0PREDICTED: truncated transcription factor CAULIFLOWER A-like isoform X2
RefseqXP_016492116.10.0PREDICTED: truncated transcription factor CAULIFLOWER A-like isoform X2
RefseqXP_016492117.10.0PREDICTED: truncated transcription factor CAULIFLOWER A-like isoform X2
RefseqXP_016492118.10.0PREDICTED: truncated transcription factor CAULIFLOWER A-like isoform X2
SwissprotQ424298e-95AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog
TrEMBLM1CIV11e-129M1CIV1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000683251e-128(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.15e-81AGAMOUS-like 8