PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016492111.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MIKC_MADS
Protein Properties Length: 312aa    MW: 35462.4 Da    PI: 9.7307
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016492111.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.51.8e-2869119151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                     krienk+ rqvtfskRr g+lKK +E+SvLCda+va+i+fs +gklyeys+
  XP_016492111.1  69 KRIENKISRQVTFSKRRSGLLKKTHEISVLCDADVALIVFSAKGKLYEYST 119
                     79***********************************************96 PP

2K-box95.49.1e-32136233299
           K-box   2 qkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                     ++++ ++++++  e+++ e+ kL ++ie Lqr++Rh++GedL+s  l+e + LeqqL+++lk+iR++Kn+l++e+i++lqkkekelqe+n+ ++k
  XP_016492111.1 136 AERKLNANDSEPKENWTLEYPKLMSRIELLQRNIRHYMGEDLDSFGLREFHGLEQQLDTALKRIRTRKNQLMHESISQLQKKEKELQEQNHLMSK 230
                     5566677888889*******************************************************************************999 PP

           K-box  97 kle 99 
                     kl+
  XP_016492111.1 231 KLK 233
                     986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.65161121IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-3861120IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.59E-3362152IPR002100Transcription factor, MADS-box
CDDcd002651.83E-4162136No hitNo description
PROSITE patternPS00350063117IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-296383IPR002100Transcription factor, MADS-box
PfamPF003192.4E-2470117IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-298398IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-2998119IPR002100Transcription factor, MADS-box
PfamPF014865.2E-27145232IPR002487Transcription factor, K-box
PROSITE profilePS5129716.08148238IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MYSLLYIYHT NNNPVSSIIL LVGSGKVGNL YAELTLEAIA IGVTRTHNLG SKGLGEVTPL  60
MGRGRVEMKR IENKISRQVT FSKRRSGLLK KTHEISVLCD ADVALIVFSA KGKLYEYSTE  120
SSMESILERY ESYSYAERKL NANDSEPKEN WTLEYPKLMS RIELLQRNIR HYMGEDLDSF  180
GLREFHGLEQ QLDTALKRIR TRKNQLMHES ISQLQKKEKE LQEQNHLMSK KLKGNEKQQT  240
EDAQWGKPNP GQSSTPFILP QIPSQSPPHV PNLTIGGPFQ STGFTSTDEG QTRHGSNSLI  300
PPWMLHHLRN KG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S3e-1861134173Myocyte-specific enhancer factor 2B
1tqe_R3e-1861134173Myocyte-specific enhancer factor 2B
1tqe_Q3e-1861134173Myocyte-specific enhancer factor 2B
1tqe_P3e-1861134173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016492111.10.0PREDICTED: agamous-like MADS-box protein AGL8 homolog isoform X1
SwissprotQ424298e-94AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog
TrEMBLM1CIV11e-128M1CIV1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000683251e-127(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4992397
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.15e-80AGAMOUS-like 8