PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016492047.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MIKC_MADS
Protein Properties Length: 212aa    MW: 24773.4 Da    PI: 9.4949
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016492047.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.54.1e-29959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien+snrqvt+skRrngi+KKA+E+ vLCda+v++iif+++gk++ey+s
  XP_016492047.1  9 KRIENSSNRQVTYSKRRNGIIKKAKEITVLCDAKVSLIIFGNSGKMHEYCS 59
                    79***********************************************96 PP

2K-box80.24.9e-2771169199
           K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                     yqk+sg++l++ak+e+l++e++++kke++++q ++Rhl+Ged++sL++keL+ +e++L+++l++i +k++e+l++  ++ q  e+e+++ + aL+
  XP_016492047.1  71 YQKTSGRRLWDAKHENLSNEIDRIKKENDSMQVKLRHLKGEDINSLNHKELMIMEEALQNGLSSISAKQSEILRMVRKNDQILEEEHKQLQYALH 165
                     8999******************************************************************************************* PP

           K-box  96 kkle 99 
                     +k +
  XP_016492047.1 166 QKEM 169
                     *976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.3E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.296161IPR002100Transcription factor, MADS-box
CDDcd002652.57E-40280No hitNo description
SuperFamilySSF554555.36E-36296IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.0E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-283859IPR002100Transcription factor, MADS-box
PfamPF014862.5E-1682163IPR002487Transcription factor, K-box
PROSITE profilePS5129713.90684170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MGRGKIEIKR IENSSNRQVT YSKRRNGIIK KAKEITVLCD AKVSLIIFGN SGKMHEYCSP  60
STTIADMLDG YQKTSGRRLW DAKHENLSNE IDRIKKENDS MQVKLRHLKG EDINSLNHKE  120
LMIMEEALQN GLSSISAKQS EILRMVRKND QILEEEHKQL QYALHQKEMA AMGGNMRVIQ  180
EEVYHQRDRD YEYQMPFALR VQPMQPNLHE RM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A4e-16260159Myocyte-specific enhancer factor 2A
3mu6_B4e-16260159Myocyte-specific enhancer factor 2A
3mu6_C4e-16260159Myocyte-specific enhancer factor 2A
3mu6_D4e-16260159Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX714170.0X71417.1 P.hybrida fbp3 mRNA.
GenBankX699470.0X69947.1 P.hybrida mRNA for pmads 2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009608638.11e-157PREDICTED: floral homeotic protein PMADS 2
RefseqXP_016492047.11e-157PREDICTED: floral homeotic protein PMADS 2
SwissprotQ074741e-150MADS2_PETHY; Floral homeotic protein PMADS 2
TrEMBLQ408831e-148Q40883_PETHY; FBP3
STRINGSolyc06g059970.2.11e-142(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46802139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.16e-87MIKC_MADS family protein