PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016490444.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 651aa    MW: 73032.5 Da    PI: 6.5132
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016490444.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.92e-094584902254
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     ++yps++++  L++++gL+++qV++WF N R +
  XP_016490444.1 458 HPYPSEADKHLLSRQTGLSKNQVSNWFINARVR 490
                     89*****************************88 PP

2BELL108.25.2e-35313384172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     er e q++k kLls+l+eVd rY +y+eq+q++++sF+ ++g+g+a+pYt+lA+ka+SrhFrc+kdai+ q+
  XP_016490444.1 313 ERCEYQRRKIKLLSMLDEVDARYTRYCEQMQAMVNSFDSMIGYGAAAPYTALAQKAMSRHFRCIKDAIVAQL 384
                     67899****************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.1E-57248382IPR006563POX domain
PfamPF075262.0E-48253381IPR006563POX domain
PROSITE profilePS5007112.276431494IPR001356Homeobox domain
CDDcd000868.07E-12434495No hitNo description
SMARTSM003895.9E-9434498IPR001356Homeobox domain
SuperFamilySSF466892.18E-16435501IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.0E-28437500IPR009057Homeodomain-like
PfamPF059202.8E-17451490IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 651 aa     Download sequence    Send to blast
MSQSFQQGFY NFSSVYERSV TKHEDMLRVQ GFEPVLPPPP PQQVEEPPGA VYDGGGMLTE  60
IISATEILDD QIQSSNYRPW PQKEQQQQLP PAINEAELPL MNSHIKALSP PRSSSSLHML  120
LPNSADTNSL LHQQGFHLLN SATVEPPSQF TWVPGSSSGE DNSTRIGRIV DGQGLSLSLS  180
RNFEAAAKLE DLRIGNGGIY LNNNQGLFGP INNNNNQHQL LHSGVVMDHH TTLHSNHQVH  240
VGYAAASPRM TNVLRNSRYV KAAQELLEEF CCVGRGNFKN QRVKKYEDEN PNSNTESEDR  300
GSSKDHPPLS AAERCEYQRR KIKLLSMLDE VDARYTRYCE QMQAMVNSFD SMIGYGAAAP  360
YTALAQKAMS RHFRCIKDAI VAQLKQTCKY LGEKDVTGSG GLTKGETPRL KMLDQKLRQQ  420
KALHQMGMLD SDAWRPQRGL PERSVNVLRA WIFEHFLHPY PSEADKHLLS RQTGLSKNQV  480
SNWFINARVR LWKPMVEEMY QQETKEVETD QDQEEEEQEK QLSAQTSMHD KISNMATSAT  540
TTTMPLSVRS EFNANERDPS KNIINYRQYA LGNQLIMLQD DTATGSSATH DVSTTVNHYF  600
TAADAADLVA NSNTAFGSQP AGDVSLTLGL RHSENVPRKT TQFQLRDFGA Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-16440498563Homeobox protein Meis2
3k2a_B4e-16440498563Homeobox protein Meis2
4xrm_A4e-16440498563Homeobox protein Meis2
4xrm_B4e-16440498563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755161e-104HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
GenBankCU4590251e-104CU459025.8 S.lycopersicum DNA sequence from clone LE_HBa-223O22 on chromosome 4, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016490444.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLK4BV620.0K4BV62_SOLLC; Uncharacterized protein
STRINGSolyc04g079830.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60721721
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-131BEL1-like homeodomain 2