PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016490194.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 226aa    MW: 26350.4 Da    PI: 9.9025
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016490194.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.74.5e-091702032255
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      +yp++ ++  LA+++gL+ +q+ +WF N+R ++
  XP_016490194.1 170 WPYPTEGDKNSLAESTGLDPKQINNWFINQRKRH 203
                     58*****************************885 PP

2ELK30.39.5e-11123144122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK +LlrK++++L+sLk EFs
  XP_016490194.1 123 ELKGRLLRKFGSHLSSLKLEFS 144
                     9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011881.7E-5123144IPR005539ELK domain
PfamPF037893.8E-7123144IPR005539ELK domain
PROSITE profilePS512139.83123143IPR005539ELK domain
PROSITE profilePS5007112.73143206IPR001356Homeobox domain
SuperFamilySSF466895.13E-20144217IPR009057Homeodomain-like
SMARTSM003892.7E-13145210IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-28148207IPR009057Homeodomain-like
CDDcd000865.41E-11155207No hitNo description
PfamPF059201.1E-17163202IPR008422Homeobox KN domain
PROSITE patternPS000270181204IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MLLRPHMKEH EQKRERLVST LVMTLRLWRP KRARMMRESS LELMAMMVAV MTPTFRPEDA  60
IGGRYFGSLV VVSHSLIEMF LCSLARTAFV FLLERRAEDD GGVSSDEELS CGEVEGQRSE  120
DNELKGRLLR KFGSHLSSLK LEFSKKKKKG KLPKEARQML LAWWNDHYRW PYPTEGDKNS  180
LAESTGLDPK QINNWFINQR KRHWKPSENM QLAVMDNLSG QFFSDD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0257151e-180AB025715.1 Nicotiana tabacum mRNA for homeobox 22, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016490194.11e-168PREDICTED: homeobox protein knotted-1-like 6
SwissprotQ84JS62e-57KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLQ9SXV41e-77Q9SXV4_TOBAC; Homeobox 22
STRINGPGSC0003DMT4000350952e-71(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7532480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.24e-48KNOTTED1-like homeobox gene 6