PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016489922.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 369aa    MW: 39775.5 Da    PI: 8.243
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016489922.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.33.9e-4273148176
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                     +CqvegC++dls+ak y++rhkvC +hsk+p+v+v+gleqrfCqqCsrfh+l+efD++krsCrrrLa hnerrrk+
  XP_016489922.1  73 RCQVEGCQVDLSDAKAYYSRHKVCGMHSKSPTVIVAGLEQRFCQQCSRFHQLTEFDQGKRSCRRRLACHNERRRKP 148
                     6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.4E-3567135IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.03571148IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-3972151IPR004333Transcription factor, SBP-box
PfamPF031101.1E-3174147IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MNGQWNSVME LGSVSSSGSN SSSSDSLNGL KFGKKIYFEN VGGGSSPVTG DGNLPPASKR  60
GRGGLVQGGQ PPRCQVEGCQ VDLSDAKAYY SRHKVCGMHS KSPTVIVAGL EQRFCQQCSR  120
FHQLTEFDQG KRSCRRRLAC HNERRRKPPS GSLFSTHYGS LSSSIFENNS SKSGSFLLDF  180
SSHPHVNESS WPTRASEQGW DHQSTASGKF LQRPWLNNSE NATSEFVLQG SATRTNYPGP  240
GVPSGECFSG VSDSSTGALS LLSNRSWGST NPPSSLGANI DGVHTPIQPS DSHAAPTNHF  300
SSPSLQFKGN EASSSLHEMP DLGLGQISQA ADNQYRGELR MGHQSGRQNM ELDHSNGYHP  360
SVQNVHWTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-30741471184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016489922.10.0PREDICTED: squamosa promoter-binding-like protein 9
TrEMBLA0A1S4BM510.0A0A1S4BM51_TOBAC; squamosa promoter-binding-like protein 9
STRINGXP_009587225.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45712241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57920.12e-51squamosa promoter binding protein-like 15