PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016489897.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MIKC_MADS
Protein Properties Length: 233aa    MW: 26392 Da    PI: 6.9532
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016489897.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.61.7e-28959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    k+i+n + rqvtfskRr g++KKAeELSvLCda+va+iifsstgkl++yss
  XP_016489897.1  9 KKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFDYSS 59
                    68***********************************************96 PP

2K-box47.86.1e-179117318100
           K-box  18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                     + ++a+L kei++  +++R++ Ge+L+ Ls+++LqqLe+ Le +l+++ + K + ++++i++lq k  +l een++L+++++e
  XP_016489897.1  91 NSDYARLTKEISQKSHQLRQMRGEELQGLSVEQLQQLERSLEAGLSRVIENKGDKIMKEINQLQVKGMQLMEENERLKQQVME 173
                     5689****************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.1E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.52161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.32E-31385IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-27323IPR002100Transcription factor, MADS-box
CDDcd002653.14E-39577No hitNo description
PfamPF003191.2E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129713.30687177IPR002487Transcription factor, K-box
PfamPF014861.4E-1592171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MVKDKIQIKK IDNATARQVT FSKRRRGLFK KAEELSVLCD ADVALIIFSS TGKLFDYSSS  60
SMKEILERHN LLSKNLQKLE QPSLELQLVE NSDYARLTKE ISQKSHQLRQ MRGEELQGLS  120
VEQLQQLERS LEAGLSRVIE NKGDKIMKEI NQLQVKGMQL MEENERLKQQ VMEISNNSSK  180
HPAIVVAVGS ENIYYEERQS SESVNNACNS TSPPPLEDHS SDTSLKLGLP YPG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D1e-18370269MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-18370269MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-18370269MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A1e-18370269MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J1e-18369268Myocyte-specific enhancer factor 2A
3p57_I1e-18369268Myocyte-specific enhancer factor 2A
3p57_D1e-18369268Myocyte-specific enhancer factor 2A
3p57_C1e-18369268Myocyte-specific enhancer factor 2A
3p57_B1e-18369268Myocyte-specific enhancer factor 2A
3p57_A1e-18369268Myocyte-specific enhancer factor 2A
3kov_J1e-18369268Myocyte-specific enhancer factor 2A
3kov_I1e-18369268Myocyte-specific enhancer factor 2A
3kov_B1e-18369268Myocyte-specific enhancer factor 2A
3kov_A1e-18369268Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009631749.11e-170PREDICTED: MADS-box protein JOINTLESS-like isoform X1
RefseqXP_016489897.11e-170PREDICTED: MADS-box protein JOINTLESS-like isoform X2
SwissprotQ9FUY61e-120JOIN_SOLLC; MADS-box protein JOINTLESS
TrEMBLD1MBJ91e-131D1MBJ9_PETHY; EXTRAPETALS
STRINGPGSC0003DMT4000417731e-126(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9382377
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.11e-117MIKC_MADS family protein