PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016489009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 133aa    MW: 15334.2 Da    PI: 8.6598
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016489009.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-09791122255
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      +yp++ ++  LA+++gL+ +q+ +WF N+R ++
  XP_016489009.1  79 WPYPTEGQKICLAESTGLDPKQINNWFINQRKRH 112
                     59*****************************985 PP

2ELK39.71e-133354122
             ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                    E+K+ L+rKYsgy++sLkqEFs
  XP_016489009.1 33 EIKDKLRRKYSGYISSLKQEFS 54
                    89*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5121310.9643353IPR005539ELK domain
SMARTSM011883.6E-73354IPR005539ELK domain
PfamPF037891.1E-103354IPR005539ELK domain
PROSITE profilePS5007111.62952115IPR001356Homeobox domain
SMARTSM003893.0E-1054119IPR001356Homeobox domain
CDDcd000861.47E-1055116No hitNo description
SuperFamilySSF466895.99E-2055126IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-2857117IPR009057Homeodomain-like
PfamPF059206.5E-1772111IPR008422Homeobox KN domain
PROSITE patternPS00027090113IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MDEGAAGLEE EAAAADTSGG GGNTNDMCRS DNEIKDKLRR KYSGYISSLK QEFSKNKKGK  60
LPREARQILL NWWTTHYKWP YPTEGQKICL AESTGLDPKQ INNWFINQRK RHWKPSENMQ  120
YAVMESIYGH FSE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0257130.0AB025713.1 Nicotiana tabacum mRNA for homeobox 9, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009595315.13e-95PREDICTED: homeobox protein knotted-1-like 2
RefseqXP_016489009.12e-97PREDICTED: homeobox protein knotted-1-like 4
SwissprotQ84JS61e-44KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLQ9SXV27e-82Q9SXV2_TOBAC; Homeobox 9
STRINGPGSC0003DMT4000874404e-56(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7532480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.24e-45KNOTTED1-like homeobox gene 6