PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016488740.1
Common NameNTH1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 325aa    MW: 36412.5 Da    PI: 4.75
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016488740.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.23.2e-092552882255
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      +yp++ee+ +L++ +gL+ +q+ +WF N+R ++
  XP_016488740.1 255 WPYPTEEEKNRLSEITGLDPKQINNWFINQRKRH 288
                     69*****************************885 PP

2ELK361.5e-12208229122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK+ L+rKYsgyL+sL++EF+
  XP_016488740.1 208 ELKETLMRKYSGYLSSLRKEFL 229
                     9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012558.9E-195599IPR005540KNOX1
PfamPF037905.9E-205798IPR005540KNOX1
SMARTSM012561.3E-26104155IPR005541KNOX2
PfamPF037912.4E-25107154IPR005541KNOX2
PROSITE profilePS5121311.243208228IPR005539ELK domain
PfamPF037891.6E-9208229IPR005539ELK domain
SMARTSM011885.6E-7208229IPR005539ELK domain
PROSITE profilePS5007112.681228291IPR001356Homeobox domain
SuperFamilySSF466892.78E-19230301IPR009057Homeodomain-like
SMARTSM003895.3E-13230295IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-26233294IPR009057Homeodomain-like
CDDcd000868.62E-13240292No hitNo description
PfamPF059204.4E-16248287IPR008422Homeobox KN domain
PROSITE patternPS000270266289IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MMDELSKLHS AIACSSNNNH VVGVLEHITG QQQEGPINNS SVDNNLEKAS LEMSDLIKAQ  60
IANHPLYPNL LSAYLQCRKV GAPQEMASIL EEISKENHLI SSGHNTEIGT DPELDEFMES  120
YCAVLLKYKE ELSKPFDEAT TFLNNIESQL SSLCKENLTT TTTTSFNSNN NYLSDEAGGT  180
SDEDLCCGEM EAADSTQESP ANREGDNELK ETLMRKYSGY LSSLRKEFLK KRKKGKLPKD  240
ARTALLEWWN THYRWPYPTE EEKNRLSEIT GLDPKQINNW FINQRKRHWR PSEDMKYALM  300
EGVSSGSIAG SMYFDGAGGT GSIGT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1223232LRKEFLKKRK
2229233KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0255730.0AB025573.1 Nicotiana tabacum NTH1 mRNA for KN1-type homeobox protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009596945.10.0PREDICTED: homeobox protein knotted-1-like 1
RefseqXP_009596946.10.0PREDICTED: homeobox protein knotted-1-like 1
RefseqXP_016488739.10.0PREDICTED: homeobox protein knotted-1-like 1
RefseqXP_016488740.10.0PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP291e-110KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLQ9SXV10.0Q9SXV1_TOBAC; KN1-type homeobox protein
STRINGSolyc01g100510.2.11e-163(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70510.12e-79KNOTTED-like from Arabidopsis thaliana 2
Publications ? help Back to Top
  1. Feng XH,Kung SD
    Identification of differentially expressed members of tobacco homeobox families by differential PCR.
    Biochem. Biophys. Res. Commun., 1994. 198(3): p. 1012-9
    [PMID:7509595]