PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016488378.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRF
Protein Properties Length: 607aa    MW: 65621.6 Da    PI: 7.9001
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016488378.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.11.8e-24224268145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  XP_016488378.1 224 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVEG 268
                     79****************************************985 PP

2QLQ61.81.9e-21156192137
             QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                     ++FT++Q+++L++Q+l+yKy+ an+P+Pp+Ll +i+k
  XP_016488378.1 156 GPFTPSQWMELEHQALIYKYITANVPIPPYLLNPIRK 192
                     59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.4E-12156192IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166624.516157192IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088807.2E-16157191IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.663224268IPR014977WRC domain
PfamPF088797.2E-21225267IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 607 aa     Download sequence    Send to blast
MDFGVVGSLD SGGVICSDNT SNMFTTAAAA AASVETKQKW YGSTGFHKNE RSSSTTTTTV  60
TEDDWNNKDI KLAKTSDDFS SSKAAAAATM LFQQQLRSNC PNSQQMLSFS SPNSQNVTMP  120
YYHYTSSPFT RNSSGCGSGA MNAGNMHGVI AAGVKGPFTP SQWMELEHQA LIYKYITANV  180
PIPPYLLNPI RKALESAGFT TFAGLRPNAL GWGAFHLGFS NSNDPEPGRC RRTDGKKWRC  240
SRDAVADQKY CERHMNRGRH RSRKPVEGQT GATSAKLMNI SSSTSASTAL APGGAASNTL  300
PLSHPQLSNL LPAVTNPSTT SPYLERNYTP KENFGERYSD TKGLVSSSEK ESLYSIQKEQ  360
NLYGATSRAE FGLVCADSLI NPLNKNSSLV NCRGYGNSED IRDQESKSQH HPLRQFMDDW  420
PKNQSDQSTV SWPDVDLQSD RTQLSISIPV VTSDFMSSTS SPANDKLTTS AQYRPSQEHE  480
TTTQMGLGIG TIISEHNQRQ GNWIPITWEN SMGGPLGEVL HSTNNSSGDC KNKSAALNLM  540
TEGWDRSPRM GLSPTGVLQK SSFGSLSNSS AGSSPRAENS KTNEGSSLCN GLLGTTLMNP  600
TLPACNM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009784651.10.0PREDICTED: growth-regulating factor 1-like
RefseqXP_016488378.10.0PREDICTED: growth-regulating factor 1-like
TrEMBLA0A1S4BHM10.0A0A1S4BHM1_TOBAC; growth-regulating factor 1-like
TrEMBLA0A1U7X4N40.0A0A1U7X4N4_NICSY; growth-regulating factor 1-like
STRINGXP_009784651.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16882357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.18e-93growth-regulating factor 1