PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016488349.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 286aa    MW: 33271.4 Da    PI: 5.5236
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016488349.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM156.11.5e-48101371128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrF P+deelv++yL +k++++++    ++ e+d++++ePw+Lp+ +k +++ewyfFs rd+ky+tg r+nrat sgyWkatgkd++vl+ 
  XP_016488349.1  10 LPPGFRFCPSDEELVCHYLFNKITNEEVIK-GTLVEIDLHTCEPWQLPEVAKLNSSEWYFFSFRDRKYTTGFRANRATISGYWKATGKDRTVLDP 103
                     79************************9555.78***************87788899**************************************9 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++ vg++ktLvfyk+rap+g kt W+mhe+r+
  XP_016488349.1 104 cTRAIVGMRKTLVFYKNRAPNGIKTGWIMHEFRV 137
                     77788***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-598156IPR003441NAC domain
PROSITE profilePS5100555.82210156IPR003441NAC domain
PfamPF023652.9E-2611137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MDLREIGATL PPGFRFCPSD EELVCHYLFN KITNEEVIKG TLVEIDLHTC EPWQLPEVAK  60
LNSSEWYFFS FRDRKYTTGF RANRATISGY WKATGKDRTV LDPCTRAIVG MRKTLVFYKN  120
RAPNGIKTGW IMHEFRVENP HIPPKEDWVL CRVFHKAKAE NNNNCTNNLS PQNTYEAAVT  180
SPELYNHSLN YDINNQNPPY QSQNSNTIHH HLFDLLVKNH LQLSHQEMNE VSKDETTVHL  240
SKCGQEDDQY GLMFDMDFEV PCLQDDGVHC NLEDMRFDDE NSMVFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-45915616165NO APICAL MERISTEM PROTEIN
1ut4_B4e-45915616165NO APICAL MERISTEM PROTEIN
1ut7_A4e-45915616165NO APICAL MERISTEM PROTEIN
1ut7_B4e-45915616165NO APICAL MERISTEM PROTEIN
3swm_A5e-45915619168NAC domain-containing protein 19
3swm_B5e-45915619168NAC domain-containing protein 19
3swm_C5e-45915619168NAC domain-containing protein 19
3swm_D5e-45915619168NAC domain-containing protein 19
3swp_A5e-45915619168NAC domain-containing protein 19
3swp_B5e-45915619168NAC domain-containing protein 19
3swp_C5e-45915619168NAC domain-containing protein 19
3swp_D5e-45915619168NAC domain-containing protein 19
4dul_A4e-45915616165NAC domain-containing protein 19
4dul_B4e-45915616165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016488349.10.0PREDICTED: NAC domain-containing protein 21/22-like
SwissprotQ84TE61e-60NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A1S4BHJ70.0A0A1S4BHJ7_TOBAC; NAC domain-containing protein 21/22-like
STRINGXP_009598091.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.14e-89NAC domain containing protein 74
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  4. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  5. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  6. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]