PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016487961.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 155aa    MW: 17184.7 Da    PI: 6.4784
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016487961.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.31.5e-4471061100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck+lrr+CakdC++apyfp ++p+kfa+vhk+FGasn++k++++lp ++r da++slvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la
  XP_016487961.1   7 PCASCKLLRRRCAKDCIFAPYFPPDDPHKFAIVHKVFGASNISKMIQELPVQQRADAVNSLVYEANARMRDPVYGCVGAISYLQNQVSQLEMQLA 101
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_016487961.1 102 MAQTE 106
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.0316107IPR004883Lateral organ boundaries, LOB
PfamPF031955.3E-447104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MGGGTSPCAS CKLLRRRCAK DCIFAPYFPP DDPHKFAIVH KVFGASNISK MIQELPVQQR  60
ADAVNSLVYE ANARMRDPVY GCVGAISYLQ NQVSQLEMQL AMAQTEILCI QMQQESAPNL  120
PAIQMEQYDG STPQALSFGS PNYLVAEQEF RRCGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-4731087112LOB family transfactor Ramosa2.1
5ly0_B1e-4731087112LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754451e-46HG975445.1 Solanum pennellii chromosome ch06, complete genome.
GenBankHG9755181e-46HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009784491.11e-113PREDICTED: LOB domain-containing protein 12
RefseqXP_016487961.11e-113PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW34e-74LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A1S4BGH11e-111A0A1S4BGH1_TOBAC; LOB domain-containing protein 12-like
TrEMBLA0A1U7X4861e-111A0A1U7X486_NICSY; LOB domain-containing protein 12
STRINGXP_009784491.11e-112(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-76LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]