PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016487941.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 319aa    MW: 36049.2 Da    PI: 4.7121
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016487941.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.11.5e-082652982255
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      +yp++ ++  LA+++gL+ +q+ +WF N+R ++
  XP_016487941.1 265 WPYPTEGQKICLAESTGLDPKQINNWFINQRKRH 298
                     59*****************************885 PP

2ELK40.27e-14218239122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     E+K+ L+rKYsgy++sLkqEF+
  XP_016487941.1 218 EIKDKLMRKYSGYISSLKQEFC 239
                     89*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.1E-1178122IPR005540KNOX1
PfamPF037901.3E-1580116IPR005540KNOX1
SMARTSM012564.6E-18128179IPR005541KNOX2
PfamPF037918.5E-21134178IPR005541KNOX2
PfamPF037894.0E-11218239IPR005539ELK domain
SMARTSM011882.4E-7218239IPR005539ELK domain
PROSITE profilePS5121310.964218238IPR005539ELK domain
PROSITE profilePS5007111.418238301IPR001356Homeobox domain
SMARTSM003891.6E-10240305IPR001356Homeobox domain
SuperFamilySSF466892.22E-19240311IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-28243302IPR009057Homeodomain-like
CDDcd000867.92E-11250302No hitNo description
PfamPF059202.8E-16258297IPR008422Homeobox KN domain
PROSITE patternPS000270276299IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MEEMYEFGSS SSAVYSVDDH LQPPYFGSPP AFCDELLPVG FGSGNMSSVC SESSAANSVV  60
DKSGTSSSNL QLEDHHETNI RAKISSYPLY PKLLRTYIDC RKVGAPSEIV DMLDNINIVH  120
ENDLYRRSNR LITGDSELDD FMGTYCDVLA KFKSDLERPF NEATTFLNDI QIQLTNLCTT  180
PVTPSSNISD EGAAGLEEEE DTSGGGGNTN DMCRSENEIK DKLMRKYSGY ISSLKQEFCK  240
KNKKGKLPKE ARQILLDWWT THYKWPYPTE GQKICLAEST GLDPKQINNW FINQRKRHWK  300
PSENMQFADM ESIYGHFSE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0257130.0AB025713.1 Nicotiana tabacum mRNA for homeobox 9, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016487941.10.0PREDICTED: homeobox protein knotted-1-like 2
SwissprotQ84JS63e-89KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLQ9SXV20.0Q9SXV2_TOBAC; Homeobox 9
STRINGVIT_17s0000g08710.t013e-94(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7532480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70510.19e-86KNOTTED-like from Arabidopsis thaliana 2