PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016486384.1
Common NameNtabSPL9b
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 139aa    MW: 14861.6 Da    PI: 9.3099
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016486384.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP79.55e-2585137153
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETT CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhels 53 
                     +CqvegCeadls++k y++rhkvC +hsk+pvv+v+gleqrfCqqCsr h  +
  XP_016486384.1  85 RCQVEGCEADLSDVKAYYSRHKVCATHSKSPVVIVAGLEQRFCQQCSRQHYRH 137
                     6************************************************9755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.3E-2579135IPR004333Transcription factor, SBP-box
PROSITE profilePS5114120.53883139IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.46E-2484138IPR004333Transcription factor, SBP-box
PfamPF031106.5E-1986134IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MNGLSKSEME LLASASSSTS TTSTSPDSPP NTLKFGQKIY FEHVGPHHPK SATGSSSSPV  60
TGTPAPTTSK KGRGGGVVQG RQPSRCQVEG CEADLSDVKA YYSRHKVCAT HSKSPVVIVA  120
GLEQRFCQQC SRQHYRHEL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A2e-1686139659squamosa promoter-binding protein-like 12
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR157. {ECO:0000305|PubMed:12202040}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLC0732990.0LC073299.1 Nicotiana tabacum NtabSPL9b mRNA for squamosa promoter binding protein NtabSPL9b, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016486384.11e-98PREDICTED: squamosa promoter-binding-like protein 9
SwissprotQ9M2Q61e-25SPL15_ARATH; Squamosa promoter-binding-like protein 15
TrEMBLA0A1S4BBW63e-97A0A1S4BBW6_TOBAC; squamosa promoter-binding-like protein 9
STRINGXP_009612109.16e-90(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45712241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57920.11e-23squamosa promoter binding protein-like 15
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Han YY,Ma YQ,Li DZ,Yao JW,Xu ZQ
    Characterization and phylogenetic analysis of fifteen NtabSPL genes in Nicotiana tabacum L. cv. Qinyan95.
    Dev. Genes Evol., 2016. 226(1): p. 1-14
    [PMID:26635304]
  3. Morea EG, et al.
    Functional and evolutionary analyses of the miR156 and miR529 families in land plants.
    BMC Plant Biol., 2016. 16: p. 40
    [PMID:26841873]
  4. Hyun Y, et al.
    Multi-layered Regulation of SPL15 and Cooperation with SOC1 Integrate Endogenous Flowering Pathways at the Arabidopsis Shoot Meristem.
    Dev. Cell, 2016. 37(3): p. 254-66
    [PMID:27134142]
  5. Xu M, et al.
    Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana.
    PLoS Genet., 2016. 12(8): p. e1006263
    [PMID:27541584]