PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016486318.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ARF
Protein Properties Length: 664aa    MW: 74273.8 Da    PI: 6.4688
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016486318.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.51.4e-24129229198
                     EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                     f+kvlt sd++++g +++ +k+a+e+     +++++ +++l+ +d++g +W +k+i+r++++r++lt+GW+ Fv++++L +gD++vF   + +++
  XP_016486318.1 129 FCKVLTASDTSTHGGFSVLRKHANEClpsldMNQQTPTQELIAKDLHGTEWHFKHIFRGQPRRHLLTTGWSTFVSSKRLVAGDSFVFL--RGENG 221
                     99****************************9555555679************************************************..44999 PP

                     ..EEEEE- CS
              B3  91 elvvkvfr 98 
                     el+v+v+r
  XP_016486318.1 222 ELRVGVRR 229
                     9*****98 PP

2Auxin_resp89.27.5e-30255333183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a+ha++t++ F v+Y+P +  s+F++ ++k+++++k+ +svGmRfkm+fe+e+s+err++Gt+vg++dl++ +W++S WrsLk
  XP_016486318.1 255 ASHAVTTQTLF-VYYKPIT--SQFIIGLNKYLETVKHGYSVGMRFKMQFEGEESPERRFTGTIVGIEDLSS-QWKDSTWRSLK 333
                     56888888888.9****95..9**********************************************777.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.83E-41117258IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.4E-42122244IPR015300DNA-binding pseudobarrel domain
CDDcd100171.91E-21127229No hitNo description
PfamPF023621.8E-22129229IPR003340B3 DNA binding domain
SMARTSM010191.8E-21129231IPR003340B3 DNA binding domain
PROSITE profilePS5086312.393129231IPR003340B3 DNA binding domain
PfamPF065079.0E-28255333IPR010525Auxin response factor
PfamPF023092.3E-7551596IPR033389AUX/IAA domain
SuperFamilySSF542771.08E-11554636No hitNo description
PROSITE profilePS5174522.418560641IPR000270PB1 domain
PfamPF023092.2E-5606643IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 664 aa     Download sequence    Send to blast
MENNGCYQSQ QQTNFSAKGK DDLYHELWKL CAGPLVDVPK DGERVYYFPQ GHMEQLEASM  60
NQELNLRIPS FNLQPKILCR VIHTQLLAEQ DTDEVYAQIT LMPEAAEQAE PTSQDPCLPE  120
PQRPKVHSFC KVLTASDTST HGGFSVLRKH ANECLPSLDM NQQTPTQELI AKDLHGTEWH  180
FKHIFRGQPR RHLLTTGWST FVSSKRLVAG DSFVFLRGEN GELRVGVRRL ARQQSSMPSS  240
VISSQSMHLG VLATASHAVT TQTLFVYYKP ITSQFIIGLN KYLETVKHGY SVGMRFKMQF  300
EGEESPERRF TGTIVGIEDL SSQWKDSTWR SLKVQWDEPA SISRPDRVSP WEIEPFVASV  360
PNPLVPPMAG KNKRHRPHIE TKISEPASSV ASAVWNPSID SPQFNTTGIN SSTLTSHTDS  420
GCGWRLPHLN ASSSMLVDET EDSKSASAWS GYPSVLSSQF SKGTNQPILS PTDERKCETI  480
TTCRLFGIDL KSTLISTAEA PLPKPANISN VSTERASPNT VPAGDSDQNS DLSIDFKDQK  540
QGQLQLLLKE VQSKQNCSTR SRTKVQMQGV AVGRAVDLTA LKGYNELIKE LEEMFEIQGE  600
LHPRNKWEIV FTDDEGDMML MGDHPWLEFC NVVRRIFIVS SQDIKKWSAG NKLLSCADNE  660
AIAF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1732135617355Auxin response factor 1
4ldw_A1e-1732135617355Auxin response factor 1
4ldw_B1e-1732135617355Auxin response factor 1
4ldx_A1e-1732135617355Auxin response factor 1
4ldx_B1e-1732135617355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016486318.10.0PREDICTED: auxin response factor 9-like isoform X1
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A1S4BBX20.0A0A1S4BBX2_TOBAC; Auxin response factor
STRINGXP_009764747.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9