PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016486218.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 402aa    MW: 45086.9 Da    PI: 7.9004
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016486218.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.52.6e-40166243178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +CqvegC++ l +ak yhrrhkvC +h+kap+v+v gleqrfCqqCsrfh +sefDe+krsCrrrLa+hnerrrk+++
  XP_016486218.1 166 RCQVEGCQVALVNAKVYHRRHKVCAMHAKAPKVVVLGLEQRFCQQCSRFHIVSEFDESKRSCRRRLAGHNERRRKSSQ 243
                     6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.1E-33164228IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.086164241IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.63E-38165246IPR004333Transcription factor, SBP-box
PfamPF031104.3E-31167240IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MENGGWNFFS NSIESCSSNN GGNGGQNSNY THAWDFWQLG STSTSTNSSQ SQLIQWNYNN  60
TFNQDPITVG QKFDYTCPLN SSELIARRVN TSIVSSSEYF IQEERDHNLM CLNLNLGKRH  120
CTENYEPPQG GGEVVGFVMN KRGKQHFPGG DGAAAAVEIP VAVAPRCQVE GCQVALVNAK  180
VYHRRHKVCA MHAKAPKVVV LGLEQRFCQQ CSRFHIVSEF DESKRSCRRR LAGHNERRRK  240
SSQDNYTNTR NPSQGNYRNI AVNEGRAHSL LSSKNDSWIS KGNLPGRCSV TINELIAESR  300
ATRLAQQLII DKDWHRHQHY PVENLNIQLK NGSSTDHKRE QVVLKSNGWG RANDAAGNLT  360
LDLMHVRNSE LGFLSEQEQL KEEGDEEGCP EHWNSFAGAH VA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-311672401184squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009789490.10.0PREDICTED: squamosa promoter-binding-like protein 7 isoform X2
RefseqXP_016486218.10.0PREDICTED: squamosa promoter-binding-like protein 7
TrEMBLA0A1S4BBM20.0A0A1S4BBM2_TOBAC; squamosa promoter-binding-like protein 7
TrEMBLA0A1U7XSM00.0A0A1U7XSM0_NICSY; squamosa promoter-binding-like protein 7 isoform X2
STRINGXP_009789489.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA134081417
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.12e-36squamosa promoter binding protein-like 3