PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016485630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 189aa    MW: 20820.9 Da    PI: 4.9268
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016485630.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.93.5e-4333131199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r+da++s+vyeA+ar+rdPvyG++g i +lq+q+++l+aela
  XP_016485630.1  33 PCAACKILRRRCVDKCVLAPYFPPTEPLKFTIAHRVFGASNIIKMLQELPEDQRTDAVNSMVYEANARIRDPVYGCAGAICQLQKQISELQAELA 127
                     7********************************************************************************************** PP

          DUF260  96 llke 99 
                     +++ 
  XP_016485630.1 128 KAQV 131
                     9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.24732133IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-4333130IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MECSDKTPAT CSSSSAGMMT PPPSPPSPVI LTPCAACKIL RRRCVDKCVL APYFPPTEPL  60
KFTIAHRVFG ASNIIKMLQE LPEDQRTDAV NSMVYEANAR IRDPVYGCAG AICQLQKQIS  120
ELQAELAKAQ VEMLNVQSQN ANLMSLICRE MSQNQQNNGS VCPDQQTYGN TSLFLDDNSI  180
YAAWEPLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-44241352113LOB family transfactor Ramosa2.1
5ly0_B2e-44241352113LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016485630.11e-139PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR04e-74LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A1S4B9N01e-138A0A1S4B9N0_TOBAC; LOB domain-containing protein 1-like
STRINGXP_009588230.11e-138(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-76LOB domain-containing protein 1