PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016485618.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 287aa    MW: 33530.6 Da    PI: 5.2104
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016485618.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.65.1e-49101381129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrF P+deelv++yL +k++++++    ++ e+d++++ePw+Lp+ +k +++ewyfFs rd+ky+tg r+nrat sgyWkatgkd++v++ 
  XP_016485618.1  10 LPPGFRFCPSDEELVCHYLFNKITNEEIIK-GTLVEIDLHTCEPWQLPEVAKLNSSEWYFFSFRDRKYTTGFRANRATISGYWKATGKDRTVFDP 103
                     79*************************766.78***************87788899**************************************9 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrle 129
                      ++e vg++ktLvfyk+rap+g kt W+mhe+rle
  XP_016485618.1 104 cTREIVGMRKTLVFYKNRAPNGIKTGWIMHEFRLE 138
                     88889***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-598156IPR003441NAC domain
PROSITE profilePS5100556.2910156IPR003441NAC domain
PfamPF023652.5E-2611137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MDLREIGATL PPGFRFCPSD EELVCHYLFN KITNEEIIKG TLVEIDLHTC EPWQLPEVAK  60
LNSSEWYFFS FRDRKYTTGF RANRATISGY WKATGKDRTV FDPCTREIVG MRKTLVFYKN  120
RAPNGIKTGW IMHEFRLENP HIPPKEDWVL CRVFHKTKSE NNNNCTNNLS PQNMYEAAVT  180
SPELYNHSLN YDINNQNPPY QSQNSNTIHH HLFDLLVKNH LQLSHQEMNE VSKDETTVNL  240
SKCSQEDDQY GLMFDMDFEV PCLQDEGVLH SSLEDMKFDD ENSMVFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-46916216171NO APICAL MERISTEM PROTEIN
1ut4_B5e-46916216171NO APICAL MERISTEM PROTEIN
1ut7_A5e-46916216171NO APICAL MERISTEM PROTEIN
1ut7_B5e-46916216171NO APICAL MERISTEM PROTEIN
3swm_A6e-46916219174NAC domain-containing protein 19
3swm_B6e-46916219174NAC domain-containing protein 19
3swm_C6e-46916219174NAC domain-containing protein 19
3swm_D6e-46916219174NAC domain-containing protein 19
3swp_A6e-46916219174NAC domain-containing protein 19
3swp_B6e-46916219174NAC domain-containing protein 19
3swp_C6e-46916219174NAC domain-containing protein 19
3swp_D6e-46916219174NAC domain-containing protein 19
4dul_A5e-46916216171NAC domain-containing protein 19
4dul_B5e-46916216171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269|PubMed:12837947, ECO:0000269|PubMed:17122068}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269|PubMed:16854978}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009801114.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
RefseqXP_016485618.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
SwissprotQ9S8511e-62NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLA0A1S4B9Z40.0A0A1S4B9Z4_TOBAC; protein CUP-SHAPED COTYLEDON 3-like
TrEMBLA0A1U7YPF40.0A0A1U7YPF4_NICSY; protein CUP-SHAPED COTYLEDON 3-like
STRINGXP_009801114.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.11e-89NAC domain containing protein 74
Publications ? help Back to Top
  1. Chen C, et al.
    Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.).
    J. Exp. Bot., 2014. 65(17): p. 4943-58
    [PMID:24962999]
  2. Gonçalves B, et al.
    A conserved role for CUP-SHAPED COTYLEDON genes during ovule development.
    Plant J., 2015. 83(4): p. 732-42
    [PMID:26119568]
  3. Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D
    SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis.
    Plant J., 2017. 90(3): p. 435-446
    [PMID:28161901]
  4. Espinosa-Ruiz A, et al.
    TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana.
    Development, 2017. 144(9): p. 1619-1628
    [PMID:28320734]
  5. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]