PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016485336.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 383aa    MW: 43529.5 Da    PI: 8.3313
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016485336.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.92.2e-41171247278
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     CqvegC+ dl+++keyhrrh++Ce hsk+p+v+v+g+e+rfCqqCsrfhelsefD++krsCrrrL++hn+rrr++q+
  XP_016485336.1 171 CQVEGCNLDLTTVKEYHRRHRICESHSKSPMVFVAGMERRFCQQCSRFHELSEFDDNKRSCRRRLSDHNARRRRSQP 247
                     **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.9E-34166232IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.462168245IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.23E-38169249IPR004333Transcription factor, SBP-box
PfamPF031104.8E-32171244IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MSKHIILLFW NFPFSVLFFF WFRFVIMDWN LKSDQLEWGW DNNISICSCS GLEFCRHAET  60
FIDEKEVNKA ENIYSLDGFS SYSLDHGSSV KSSAEQCNYG KVGSVPGFVS VERKEKYSTF  120
GTCTRPGESS IGLNLYSANN ETVTNYPLLP LSSTTAKRCK GSYHLMQNPY CQVEGCNLDL  180
TTVKEYHRRH RICESHSKSP MVFVAGMERR FCQQCSRFHE LSEFDDNKRS CRRRLSDHNA  240
RRRRSQPEAN HFSSTGRPSS FHDRQSRTSG SLSGSSMSTS NSMGKNSCRP KNIRGLNTST  300
SDYKLDVSSN LQRRAHSLLS TNSLGWDDPT HTSMEQLIMP SSVSASQPFV HSVTPNWPQV  360
SSEHFPADHQ VPFYSPHCFN GSA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-271712441184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016485336.10.0PREDICTED: squamosa promoter-binding-like protein 11
TrEMBLA0A1S4B8W70.0A0A1S4B8W7_TOBAC; squamosa promoter-binding-like protein 11
STRINGXP_009623325.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA136441216
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.38e-40squamosa promoter binding protein-like 2