PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016485234.1
Common NameNtabSPL8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 246aa    MW: 28326.2 Da    PI: 8.8274
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016485234.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.84.7e-41159235278
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     Cq++gC+adl++ak+yhrrhkvCe+hska++v+++gl+qrfCqqCsrfh lsefD++krsCr+rLa+hn+rrrk+q+
  XP_016485234.1 159 CQADGCNADLTHAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQQCSRFHVLSEFDNGKRSCRKRLADHNRRRRKNQQ 235
                     **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.8E-35152220IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.103156233IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.72E-38157234IPR004333Transcription factor, SBP-box
PfamPF031103.3E-31159232IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MLDYEWGIGE ETTQETDQND QFFDPFVNPH AHFPPISNHP DQRQQQQQIQ NHQFPQFQTT  60
PNNNHFNSLY NPHTNDVPYS QTHHTSMLSL QPTGSAGFNM VLPKSEPQFV GGIDFTNTSR  120
IGLNLGGRTY FASSEDDFVN RLFRRTRAVE GGSVNSPKCQ ADGCNADLTH AKHYHRRHKV  180
CEFHSKAATV IAAGLTQRFC QQCSRFHVLS EFDNGKRSCR KRLADHNRRR RKNQQVINKK  240
QPQFES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-31152232484squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. Binds specifically to the 5'-GTAC-3' core sequence. Involved in development and floral organogenesis. Required for ovule differentiation, pollen production, filament elongation, seed formation and siliques elongation. Also seems to play a role in the formation of trichomes on sepals. May positively modulate gibberellin (GA) signaling in flower. {ECO:0000269|PubMed:12671094, ECO:0000269|PubMed:16095614, ECO:0000269|PubMed:17093870}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLC0732970.0LC073297.1 Nicotiana tabacum NtabSPL8 mRNA for squamosa promoter binding protein NtabSPL8, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001312706.10.0squamosa promoter-binding-like protein 8
RefseqXP_016485233.10.0PREDICTED: squamosa promoter-binding-like protein 8
RefseqXP_016485234.10.0PREDICTED: squamosa promoter-binding-like protein 8
SwissprotQ8GXL35e-75SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBLA0A125SZN60.0A0A125SZN6_TOBAC; Squamosa promoter binding protein NtabSPL8
STRINGXP_009593420.10.0(Nicotiana tomentosiformis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.11e-73squamosa promoter binding protein-like 8
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Han YY,Ma YQ,Li DZ,Yao JW,Xu ZQ
    Characterization and phylogenetic analysis of fifteen NtabSPL genes in Nicotiana tabacum L. cv. Qinyan95.
    Dev. Genes Evol., 2016. 226(1): p. 1-14
    [PMID:26635304]
  3. Xing S, et al.
    SPL8 Acts Together with the Brassinosteroid-Signaling Component BIM1 in Controlling Arabidopsis thaliana Male Fertility.
    Plants (Basel), 2013. 2(3): p. 416-28
    [PMID:27137384]