PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016484723.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family FAR1
Protein Properties Length: 776aa    MW: 88015.6 Da    PI: 6.8705
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016484723.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR126.32.5e-0845864990
            FAR1 49 ekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90
                    ++  +++++   +C+a+l+v+++ ++kw+vtk  +eH+H+l+
  XP_016484723.1 45 DEVVEPQTVYGESCDAMLRVELKGQNKWVVTKYMKEHSHSLV 86
                    3566678888899***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.4E-64586IPR004330FAR1 DNA binding domain
PfamPF105511.8E-27224315IPR018289MULE transposase domain
PROSITE profilePS5096611.226502538IPR007527Zinc finger, SWIM-type
PfamPF044341.4E-9502536IPR007527Zinc finger, SWIM-type
SMARTSM005751.8E-6513540IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 776 aa     Download sequence    Send to blast
MDVEVIDVEQ GSMQHQGGIT DDGDDEPSES GEANVNGRSN APERDEVVEP QTVYGESCDA  60
MLRVELKGQN KWVVTKYMKE HSHSLVHPNK VHYHTSHRHF AVAKKNGPEN NQGVGIVPSG  120
VMYVSVDGNR IPLEINRGAK STRSAESDQT VKDNVPQSFS PRQCNQRRTL GRVAQNLLNY  180
FKKMQAENPG FYYAIQLDKD NRMANVFWAD ARSRNAYSHF GDAVILDTMY RVNQCRVPFA  240
PFTGVNHHGQ TILFGCALLL DESEATFVWL FKTFLAAMND RAPVSIITDQ DTVIQSAVAQ  300
VFPGTRHCIN KWHVLRGGQD RMAHVCHMYP NFQVELYNCI NLTETVEEFE SYWETILEKY  360
DLKKNDWLQS IYNTRRQWVP AYFRDTFFAA LSPNQEYECS FFDGYVNQQI TLPLFFRQYE  420
RALENSFEKE IEADFDTICT TPPLRTPSPM EKQAATLYTK KIFLKFQEEL VETFVYTANR  480
IDGDGALSTF RVAKFEDDQK AYVVSLNISE LKANCSCQMF ECSGILCRHI LTVFTVTNVL  540
TLPSHYILKR WTINAKCRAE SDDHVQLHGT ESMAQKYNSL CREAIRYAEE GAVAQETYKA  600
ALAALKEGGK KVALAKRNVA KVSPPSSQVS GVGYDDRRMS ASAPEMTPLL WPRQDEMTKR  660
FNLNDTGIPA RTIADLNAQR MAPVSLHRGD GHADNTVILP CLKSMTWVME NKTSTPANRV  720
AVINLKLQDY SRTLSRESEV KFQLSRVTLE PMLKSMAYIS EQLSTPANRV AVINLK
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754450.0HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016484723.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 3-like, partial
SwissprotQ9ZVC90.0FRS3_ARATH; Protein FAR1-RELATED SEQUENCE 3
TrEMBLA0A1S4B7F10.0A0A1S4B7F1_TOBAC; protein FAR1-RELATED SEQUENCE 3-like
STRINGXP_009776131.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43522109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27110.20.0FAR1-related sequence 3
Publications ? help Back to Top
  1. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]