PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016482451.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 329aa    MW: 35907.7 Da    PI: 8.3427
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016482451.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.51.2e-4026102278
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     C v+gC+adls+++eyhrrhkvCevhsk+++v++ g+ qrfCqqCsrfh+l efD++krsCr+rL++hn+rrrk+q+
  XP_016482451.1  26 CLVDGCNADLSQCREYHRRHKVCEVHSKTAKVTIGGRDQRFCQQCSRFHSLVEFDDGKRSCRKRLDGHNRRRRKPQP 102
                     **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.7E-322187IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.68423100IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.66E-3824105IPR004333Transcription factor, SBP-box
PfamPF031103.9E-302699IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MESSSSSSSS SKRAKAPGNI AQVAHCLVDG CNADLSQCRE YHRRHKVCEV HSKTAKVTIG  60
GRDQRFCQQC SRFHSLVEFD DGKRSCRKRL DGHNRRRRKP QPDSMAKTSG LLFTGQQGTK  120
LLSFSSQQIF PSAAAWAGVV KTDSEMVLYN NQSHINCMDN QNSFPDSSAR SYKGGNQFQF  180
MQGSDRSLPE ASIYQPLVDH PNSAVAAAVP SSGQKIFSSG LNEIVDSDRA LSLLSSAPAV  240
TREIGFSHMV QQPATIPRPQ SQSVVHSLHY GGLSQYPFAQ DFNSQPQDSA ADSHVSNNSS  300
LHFHDMLQNG ADGSSTSGGC QQTLAFMWD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-2826991184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18299KRSCRKRLDGHNRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLC0733000.0LC073300.1 Nicotiana tabacum NtabSPL13 mRNA for squamosa promoter binding protein NtabSPL13, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016482449.10.0PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_016482450.10.0PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_016482451.10.0PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_016482452.10.0PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_016482453.10.0PREDICTED: squamosa promoter-binding-like protein 16
TrEMBLA0A1S4B0J60.0A0A1S4B0J6_TOBAC; squamosa promoter-binding-like protein 16
STRINGXP_009764314.10.0(Nicotiana sylvestris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.15e-50SBP family protein