PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016482365.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 301aa    MW: 33516.3 Da    PI: 5.8256
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016482365.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.82e-39101101101
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rr+C++dC+lapyfpa+qpk f+n+h+lFG+sn+lk+lk+l++++++ am+s++y+A+ar + PvyG+v+ i++l  +++  ++el+
  XP_016482365.1  10 ACAACKYQRRRCTSDCPLAPYFPADQPKMFQNAHRLFGVSNILKILKQLDPSQKKVAMKSIIYQANARDKHPVYGCVAEIQNLVFNIQLYEEELQ 104
                     7********************************************************************************************** PP

          DUF260  96 llkeel 101
                     +++++l
  XP_016482365.1 105 AVHAQL 110
                     *99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.6339110IPR004883Lateral organ boundaries, LOB
PfamPF031955.0E-3810107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MTLKGGTSQA CAACKYQRRR CTSDCPLAPY FPADQPKMFQ NAHRLFGVSN ILKILKQLDP  60
SQKKVAMKSI IYQANARDKH PVYGCVAEIQ NLVFNIQLYE EELQAVHAQL AFYRQQHQQQ  120
EISSTALSDS VSQIQLGMPP PPPPPPPQPA NGNGLTLFHQ DAPSQQYNAL PVQSYPSYSN  180
NSYAAYNNNT TFVDPKDNNA VNSLWIQQSY GNSACNNNTM IMQSQLPASQ AISVPPEVTQ  240
DYDEIHPFFD TIDDRQSYID SKEAYDSSSE SSLKDTRHSV EHVAENELKS AAACFTLTSV  300
N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-2961137114LOB family transfactor Ramosa2.1
5ly0_B3e-2961137114LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016482365.10.0PREDICTED: LOB domain-containing protein 27-like
TrEMBLA0A1S4B0910.0A0A1S4B091_TOBAC; LOB domain-containing protein 27-like
STRINGXP_009588931.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14492375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.13e-52LOB domain-containing protein 27