PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016481940.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 165aa    MW: 19242.8 Da    PI: 9.1536
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016481940.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.31.7e-4153128176
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                     +Cqve+C  dls ak+y++rhk+C+vh+kap v+v+gl+qrfCqqCsrfhe+sefD +krsCrrrLa+hnerrrk+
  XP_016481940.1  53 CCQVEKCGLDLSGAKKYYKRHKLCQVHAKAPIVFVAGLRQRFCQQCSRFHEVSEFDGTKRSCRRRLAGHNERRRKT 128
                     6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.4E-3246115IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.04351128IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.41E-3852130IPR004333Transcription factor, SBP-box
PfamPF031107.3E-3354127IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MATHIHGMLL KNIAENNDFD EEEETEEEEE ESNLKRKRLN VEKKKGSNSE GPCCQVEKCG  60
LDLSGAKKYY KRHKLCQVHA KAPIVFVAGL RQRFCQQCSR FHEVSEFDGT KRSCRRRLAG  120
HNERRRKTPL AIKLEDNQCR QINGEDRPQL TLTNRKASFK NYHIL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-32541271184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009788885.11e-120PREDICTED: squamosa promoter-binding-like protein 3
RefseqXP_016481940.11e-120PREDICTED: squamosa promoter-binding-like protein 3
SwissprotQ387402e-40SBP2_ANTMA; Squamosa promoter-binding protein 2
TrEMBLA0A1S4AZ431e-118A0A1S4AZ43_TOBAC; squamosa promoter-binding-like protein 3
TrEMBLA0A1U7XQY51e-118A0A1U7XQY5_NICSY; squamosa promoter-binding-like protein 3
STRINGXP_009788885.11e-119(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74924105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.11e-38squamosa promoter binding protein-like 3
Publications ? help Back to Top
  1. Klein J,Saedler H,Huijser P
    A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA.
    Mol. Gen. Genet., 1996. 250(1): p. 7-16
    [PMID:8569690]