PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016481857.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRF
Protein Properties Length: 356aa    MW: 39641.9 Da    PI: 7.8464
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016481857.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.47.1e-2583127145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e+
  XP_016481857.1  83 DPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVES 127
                     79****************************************986 PP

2QLQ65.51.3e-222257237
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                    +FTa Q+q+L++Q+++yKyL+a++PvPp+L+++i++
  XP_016481857.1 22 PFTAVQWQELEHQAMIYKYLVAGLPVPPDLVVPIRR 57
                    9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009517.9E-132157IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166624.3432257IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.4E-172256IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.76283127IPR014977WRC domain
PfamPF088794.2E-2184126IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MSGSTSTSVV GGGGYGYGYR PPFTAVQWQE LEHQAMIYKY LVAGLPVPPD LVVPIRRSFE  60
AISARFFHHP SLGYCSYYGK KFDPEPGRCR RTDGKKWRCS KDAYPDSKYC ERHMHRGRNR  120
SRKPVESQSA SQSLSTSMSH ITTGSSNTRG SFQSSSCGSF QHMPLYSVAN SEELNYGSSA  180
TKLQMELVSY GIDNKDYRYL HGIAPDADEH NLSSETSATV RNLGMGTTMD STWVLPSQVS  240
SSPTARPKND SQLLGSSQQM HLPNLLEPMI DSTISKRRHQ HCFFGSEIDS PGTVKQEQQS  300
MRPFFNEWPT AKESWSNLDD EESNKNNFST TQLSISIPMA PSDFSSRSAC SPNGEN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3031710.0AY303171.1 Solanum bulbocastanum chromosome 8 clone UW177O13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009605689.10.0PREDICTED: growth-regulating factor 4-like isoform X1
RefseqXP_016481857.10.0PREDICTED: growth-regulating factor 4-like isoform X1
RefseqXP_016481858.10.0PREDICTED: growth-regulating factor 4-like isoform X1
TrEMBLA0A1S4AYW50.0A0A1S4AYW5_TOBAC; growth-regulating factor 4-like isoform X1
STRINGXP_009605688.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7432384
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-49growth-regulating factor 5