PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016481117.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family G2-like
Protein Properties Length: 400aa    MW: 46535.6 Da    PI: 8.6818
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016481117.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.79.9e-32102155255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     prlrWtpeLH++Fv+a+e LGG+e+AtPk +l+lm+v gL+++hvkSHLQ+YR+
  XP_016481117.1 102 PRLRWTPELHRSFVHAIETLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRS 155
                     8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.74898158IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.8E-3098156IPR009057Homeodomain-like
SuperFamilySSF466894.3E-15100156IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-22102157IPR006447Myb domain, plants
PfamPF002493.2E-8103154IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MTENSVKQAN EEMMRNTMEY IMETSSDSSS QSKMVSFIDL NEDNKRESEE EEEEAAIEVS  60
VENSSEKTTD EGNSENYNNS CGDGSGRVEK KNVRHYVRSK MPRLRWTPEL HRSFVHAIET  120
LGGQERATPK LVLQLMNVRG LSIAHVKSHL QMYRSKKLDE SGQVLGRNRA MQGRSYFYRN  180
VGQRYNPLQD FKMKNGAIVL ARNFNYDHDH VKGHFRNSFS RPPYDQTKDI FSRYLQWSSN  240
QGGLLNNTTR EKLSTPRQFQ KNGGHEIGSI RSSQFREEKR WPPSVFIANQ WEEKNSDFSN  300
ICSAKNSQYL LQQNVAQPYS KWNCKYNNLE QNFETPSRLE MKEDKSFTGK GWLPDLQLRL  360
SRSTESENEK NTHHSKRMDH QSEMNTMLSL SLPTYSLSET
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-18103157458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-18103157458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A5e-18103157357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-18103157357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-18103157357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-18103157357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-18103157458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-18103157458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-18103157458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-18103157458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-18103157458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-18103157458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016481117.10.0PREDICTED: uncharacterized protein LOC107802181
TrEMBLA0A1S4AWW20.0A0A1S4AWW2_TOBAC; uncharacterized protein LOC107802181
STRINGXP_009613587.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55162334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-35G2-like family protein