PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016480967.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 189aa    MW: 20688.4 Da    PI: 5.9007
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016480967.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.61.8e-4241139199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C ++Cvlapyfp ++p kf n+h++FGasn++k l++l e++r da++s+vyeA+ar+rdPvyG++g i++lq+q++ l+a+la
  XP_016480967.1  41 PCAACKILRRRCIDKCVLAPYFPPTEPLKFTNAHRVFGASNIIKSLQELGEDQRADAVNSMVYEANARIRDPVYGCAGAIWQLQKQISDLQAQLA 135
                     7********************************************************************************************** PP

          DUF260  96 llke 99 
                     +++ 
  XP_016480967.1 136 KAQV 139
                     9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.37840141IPR004883Lateral organ boundaries, LOB
PfamPF031953.4E-4241138IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MDCVNKTTII TTSQTLASSS FSAGGSTAAP PSSPPVVPIT PCAACKILRR RCIDKCVLAP  60
YFPPTEPLKF TNAHRVFGAS NIIKSLQELG EDQRADAVNS MVYEANARIR DPVYGCAGAI  120
WQLQKQISDL QAQLAKAQVE MLNVQSQNAN LEMSQNQVNK DKNDAQFYGN TSLFLEDNSV  180
YAAWEPLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-434114311113LOB family transfactor Ramosa2.1
5ly0_B5e-434114311113LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009776231.11e-140PREDICTED: LOB domain-containing protein 1-like
RefseqXP_016480967.11e-140PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR08e-70LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A1S4AWG41e-138A0A1S4AWG4_TOBAC; LOB domain-containing protein 1-like
TrEMBLA0A1U7WG431e-138A0A1U7WG43_NICSY; LOB domain-containing protein 1-like
STRINGXP_009776231.11e-139(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.17e-72LOB domain-containing protein 1