PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016480179.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 707aa    MW: 77203.9 Da    PI: 7.0429
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016480179.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.91.9e-093954321954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  XP_016480179.1 395 FEHflHPYPKDSDKMMLAKQTGLTRSQVSNWFINARVR 432
                     554459******************************88 PP

2BELL113.51.1e-36259330172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erqe+q+kkakL+++l+eV++rY++y++q+q vis  e++ag+gsak Yt+lAl++iS++FrcLkdai++qi
  XP_016480179.1 259 ERQEIQMKKAKLVNMLDEVEQRYRHYHQQMQSVISWLEQAAGIGSAKTYTALALQTISKQFRCLKDAITGQI 330
                     79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.9E-53176328IPR006563POX domain
PfamPF075262.4E-46185327IPR006563POX domain
PROSITE profilePS5007112.147373436IPR001356Homeobox domain
SMARTSM003899.7E-10376440IPR001356Homeobox domain
CDDcd000865.53E-12376437No hitNo description
SuperFamilySSF466896.42E-17377442IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-28379442IPR009057Homeodomain-like
PfamPF059203.8E-18393432IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 707 aa     Download sequence    Send to blast
MAAYFPGNSE IQGGNDGLQT LILMNPAGYV GFSETQHHQP PAGGSNLVFF NSNPPGNSLN  60
LSHAPPSSQQ QFVGIPLATS AFTAPSSQDG TTTPTVHSQH DISALHGFLA RSHEYGFYNP  120
SNNITEAREV TRAQQQGLSL SLSSQQPGFG NFRPEREELM TTVSPTAVGG SSSSASAVQS  180
VPLSPKYLKA AQELLDEVVN VGKAVKTSTT DEDVNDGQKS KNNGELSGNM ATAAAAATAG  240
QEGGESNSKR DGAELSTAER QEIQMKKAKL VNMLDEVEQR YRHYHQQMQS VISWLEQAAG  300
IGSAKTYTAL ALQTISKQFR CLKDAITGQI RSASKTLGEE DSFGGKIEGS RLKFVDNQIR  360
QQRALQQLGM IQHNAWRPQR GLPERAVSVL RAWLFEHFLH PYPKDSDKMM LAKQTGLTRS  420
QVSNWFINAR VRLWKPMVEE MYLEEIKEQE QNGSELEKTS KLREQNEDST SRSIAPQEKS  480
PRSDSQNKSF LSKQDNNLAN HNPASTIPIS NTTSISPTGL RIRNNTSFNL IGSPEIKSIN  540
IGQGSPKKPR SNEILHSPNS VPSINMDVKP NEEQMLIKFG DDRQNRDGFS LMGGPTNFMG  600
GFGSYPIGEI GRFSTEQFSA PYSTSGTVSL TLGLPHSENL SMSATHHSFL PIPTQSIQMG  660
RGVEIGEANE FGSLNTPTSA HSTSVYENFN IQNRKRFAAP LLPDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16382440563Homeobox protein Meis2
3k2a_B2e-16382440563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6863850.0EU686385.1 Solanum etuberosum BEL29 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009787672.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_009787673.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_009787674.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016480177.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016480178.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016480179.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ561e-162BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLM1BX380.0M1BX38_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000549450.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-142BEL1-like homeodomain 1