PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016478448.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRF
Protein Properties Length: 372aa    MW: 40598.1 Da    PI: 9.2881
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016478448.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC811e-25143186144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrCrRtDGKkWRCsr+v++g+k+CErH+hrgrsrsrk++e
  XP_016478448.1 143 DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHVHRGRSRSRKPVE 186
                     79***************************************987 PP

2QLQ45.22.9e-1674109136
             QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                     s+F+  Q+q+L+ Q+l+y+++ a++PvPpeLl  ++
  XP_016478448.1  74 SYFSLGQWQELELQALIYRHFTAGAPVPPELLHLVK 109
                     789****************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.8E-774110IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166617.86675110IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.2E-1076108IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.141143187IPR014977WRC domain
PfamPF088791.2E-21144186IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MDFNLKQWRN QQHESEEQET PTSSAKIPRL HLDFDSVSAS DSDSALPLFV SEPTTKLSDS  60
TTTTPTKFPK MGSSYFSLGQ WQELELQALI YRHFTAGAPV PPELLHLVKK SIITSPSSYY  120
FSHPFQQYPH YQQTCYWGRA AMDPEPGRCR RTDGKKWRCS RDVVAGQKYC ERHVHRGRSR  180
SRKPVEIPTP AINGGKLNTS TTVSHQNLAK MAGHSAAAAA ATHFSISGPS PSIQTLHLNQ  240
RPSESKKGPL EAQKDVVSSD GKSSGQILRQ FFDDWPSQLQ EVDNVGSNSS SVASATSLSI  300
SMPGNPSSDF SLKLSTGGDG YNTDAQVGNV QRSAWRTSMG GGPLAEALRS STTNSSPTSV  360
LHQLPRGSTS LT
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0139772e-57BT013977.1 Lycopersicon esculentum clone 133022R, mRNA sequence.
GenBankHG9754492e-57HG975449.1 Solanum pennellii chromosome ch10, complete genome.
GenBankHG9755222e-57HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016478448.10.0PREDICTED: growth-regulating factor 3-like isoform X2
TrEMBLA0A1S4APN70.0A0A1S4APN7_TOBAC; growth-regulating factor 3-like isoform X2
STRINGXP_009771979.10.0(Nicotiana sylvestris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52910.13e-72growth-regulating factor 4