PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016478049.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 732aa    MW: 80956 Da    PI: 7.1639
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016478049.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-094414781954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  XP_016478049.1 441 FEHflHPYPKDSDKIMLAKQTGLTRSQVSNWFINARVR 478
                     554459******************************88 PP

2BELL119.71.3e-38302373172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +rqelq+kkakL+s+l+eV++rY+qy++q+q++++sFe++ag+gsak+Yt+lAl++iS++FrcLkdai++qi
  XP_016478049.1 302 QRQELQMKKAKLISMLDEVEQRYRQYHHQMQIIVASFEEAAGIGSAKSYTQLALHTISKQFRCLKDAITGQI 373
                     69*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.1E-57223371IPR006563POX domain
PfamPF075263.9E-47230370IPR006563POX domain
PROSITE profilePS5007112.05419482IPR001356Homeobox domain
SMARTSM003894.2E-10422486IPR001356Homeobox domain
CDDcd000865.95E-12422483No hitNo description
SuperFamilySSF466895.56E-17423489IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.4E-29425488IPR009057Homeodomain-like
PfamPF059202.9E-18439478IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 732 aa     Download sequence    Send to blast
MAMYYQGSSE IQADGLQTLY LMNPNYIGYT DTQQQEQQQQ QHLQQANMFF LNSGTAGNLP  60
LGQLPSQAHT QHFVGVPLQT SFQDPSRPSV HEVSHHGLLQ RLWSSNGQNS GGSGGNESQS  120
HIPSAVVSPN SGGGTTTDFA SQLGFQRPGL VSPTQQHQGL SLSLSPQQQQ QQQQQQMINF  180
RSFPLDHHEI SPHNNHQVGI LSSSSPRTNT NNDHIRGSGA SSSSFSNGMI VGSKYLKAAQ  240
ELLDEVVNVG KNIKEVGAKE KDKLLDNELM PLSSDVAAAA PTSGSGESSS QKNSVAELTT  300
VQRQELQMKK AKLISMLDEV EQRYRQYHHQ MQIIVASFEE AAGIGSAKSY TQLALHTISK  360
QFRCLKDAIT GQIKATSKSL GEEEINLGGK IEGSSSRLRF VDHHLRQQRA LQQLGMMQPN  420
AWRPQRGLPE RAVSVLRAWL FEHFLHPYPK DSDKIMLAKQ TGLTRSQVSN WFINARVRLW  480
KPMVEEMYLE EVKNNQEQNG LEENANKNNE PNKEMCTKSS APQETTNLRK DKQISSILQD  540
ASPTEISSST ISTSPTGGSL PAQAAGFSFI GSLNMENSTS ERNNKKARND MQNSSSSILS  600
METEMKAGDT RKGEKFNGDN RQARDQSYPL MTAYSTMGEF GRFNPEQQMA TSFQGNGVSL  660
TLGLPPSENL VLSGSQHNFL PNQNIGIEMG RIETHYNRMS NPQPSHPNIT YENIDFQSGK  720
RYAAQLLPDF VS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B4e-16428486563Homeobox protein Meis2
3k2a_A4e-16428486563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009778869.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_009778870.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_009778871.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016478049.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016478051.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016478052.10.0PREDICTED: BEL1-like homeodomain protein 1
TrEMBLM1BQG30.0M1BQG3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000505270.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14782467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.32e-94BEL1-like homeodomain 1