PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016477978.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 590aa    MW: 65296.3 Da    PI: 6.8617
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016477978.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.7e-093824142254
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     ++yp+ +++  LAk++gL+ +qV++WF N R +
  XP_016477978.1 382 HPYPTDSDKVMLAKQTGLSRNQVSNWFINARVR 414
                     89*****************************88 PP

2BELL993.8e-32245314372
            BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      e+++ k+kL+s+l+eV++rYkqy++qlq+v++sFe v glg+a p+++l lka+S+hFrcLk+ai++q+
  XP_016477978.1 245 SEHRRNKSKLISMLNEVYRRYKQYYQQLQAVMASFESVPGLGNASPFAKLSLKALSKHFRCLKNAITDQL 314
                     79999**************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.8E-47182312IPR006563POX domain
PfamPF075262.7E-36187311IPR006563POX domain
PROSITE profilePS5007112.034355418IPR001356Homeobox domain
SMARTSM003892.7E-10358422IPR001356Homeobox domain
CDDcd000863.28E-12358419No hitNo description
SuperFamilySSF466895.99E-17360425IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-27361422IPR009057Homeodomain-like
PfamPF059201.4E-18375414IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 590 aa     Download sequence    Send to blast
MAEGFEAYHV PQQSRRDRLR VSASGLLPFV DHPSLIPSDF HLVSDAKEKG VNFMDPQLSS  60
GVSFQEISGN PFLYSHQNFR FLDQSFHGGD VDVAYKQEPF SSVAASPETN VIINNNNNSN  120
SNNNVTTGQG LSLSLSSSHH YNQSSSSNLP LELNLQRYDS SIFTNDMSSK SSSATVPLGP  180
FTGYASILKG SRFLKPAQQL LEELCDVGRG IYAENLAAND GFIVMDPSLE ATLSDDPQYS  240
CGDASEHRRN KSKLISMLNE VYRRYKQYYQ QLQAVMASFE SVPGLGNASP FAKLSLKALS  300
KHFRCLKNAI TDQLQYTGKS QICESDTIPR AGNPAGKGIY CQRQAIHNAG FVDHQPVWRP  360
QRGLPERAVT VLRAWLFDHF LHPYPTDSDK VMLAKQTGLS RNQVSNWFIN ARVRLWKPMV  420
EEIHNLETRQ AQKAASQKEG QNNNNNPIEH FPTSNSLPSE HPSTSSQQFH DVPSKRTRNN  480
DPSETHLGGD DQETMNLSYD NFSPHSRAGV VDQMSTASAG NGGVSLTLGL NQNNNVSIGL  540
SGSFPRNAAR RFGIDENNEG FMFGGFETQN RQLGRDNNII GGQLLHDFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B9e-16364421158Homeobox protein Meis1
4xrs_A9e-16364421158Homeobox protein Meis1
5bng_A1e-15364422159Homeobox protein Meis2
5bng_B1e-15364422159Homeobox protein Meis2
3k2a_B1e-15364422563Homeobox protein Meis2
3k2a_A1e-15364422563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016477978.10.0PREDICTED: BEL1-like homeodomain protein 9
TrEMBLF6HL250.0F6HL25_VITVI; Putative uncharacterized protein
STRINGVIT_08s0007g01290.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35202237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.11e-104TALE family protein