PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016477805.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRF
Protein Properties Length: 412aa    MW: 45885.4 Da    PI: 9.5658
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016477805.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC695.9e-22114157145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRC+r+v++g+k+C  H+hrg  rsrk +e+
  XP_016477805.1 114 DPEPGRCRRTDGKKWRCKRDVIPGQKYCGQHMHRG-RRSRKLVEA 157
                     79*********************************.688888876 PP

2WRC58.89.4e-19299333337
             WRC   3 epgrCrRtDGKkWRCsrrvlegkklCErHlhrgrs 37 
                     e  rCrR+DGKkWRCsr++++ +k+CE H+hrg +
  XP_016477805.1 299 ELQRCRRSDGKKWRCSRNAVPRQKYCETHMHRGAK 333
                     668*****************************976 PP

3QLQ42.12.6e-155086137
             QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                    s FT aQ+++L  Q+ ++Ky+++++PvP +L + i++
  XP_016477805.1 50 SVFTTAQFHELQLQAVIFKYIVSGLPVPFHLFFTIWN 86
                    67*****************************999997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.3E-65086IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166616.8185186IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.0E-115285IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166722.678114158IPR014977WRC domain
PfamPF088793.8E-18115152IPR014977WRC domain
PROSITE profilePS5166719.778297341IPR014977WRC domain
PfamPF088792.0E-16300334IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MQPHLSSATP LSHSGKDERE KKEGSPPCIK LSLGYVVEEE EKVANAIAKS VFTTAQFHEL  60
QLQAVIFKYI VSGLPVPFHL FFTIWNTVSS SLGSAVINKL YPTLGRFDYA SMMDPEPGRC  120
RRTDGKKWRC KRDVIPGQKY CGQHMHRGRR SRKLVEASEY VTKSDDISIT SKRIKLNARS  180
DDPGSKCAPA SSKTSCLSST SRNYQNNSVE DSSAKPRPTN SCNSSEKQDN HMTFNRKDTT  240
TCIRTQSFNT DSKNIDFNRI SPSKANQKQS YGDARNSGGL VPVFGISAKS DLQHTTETEL  300
QRCRRSDGKK WRCSRNAVPR QKYCETHMHR GAKKIMAASD SVINVEPSKP SSYRFCHQVI  360
PKNDGTGINL NTSLSISTLP DPRNITEDDD SNSNSTSDAT TITDEIPAFV SH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009632013.10.0PREDICTED: growth-regulating factor 9
RefseqXP_016477805.10.0PREDICTED: growth-regulating factor 9-like
TrEMBLA0A1S4AMG50.0A0A1S4AMG5_TOBAC; growth-regulating factor 9-like
STRINGXP_009632013.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA77981922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45480.19e-36growth-regulating factor 9