PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016477556.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 771aa    MW: 84062 Da    PI: 6.8725
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016477556.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.7e-095595961954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  XP_016477556.1 559 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 596
                     664459******************************88 PP

2BELL122.12.3e-39420491172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +r e+q++k+kLls+l+eVd+rY++y+eq+q+v++sF+ v+g g+a pYt+lA+ka+SrhFrcLkdai+ q+
  XP_016477556.1 420 DRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDLVMGFGAAIPYTALAQKAMSRHFRCLKDAITAQL 491
                     589******************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005749.9E-81346489IPR006563POX domain
PfamPF075266.0E-54351488IPR006563POX domain
PROSITE profilePS5007112.568537600IPR001356Homeobox domain
SMARTSM003891.2E-9540604IPR001356Homeobox domain
CDDcd000861.08E-12540601No hitNo description
SuperFamilySSF466893.64E-17542607IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.3E-29543606IPR009057Homeodomain-like
PfamPF059203.9E-18557596IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 771 aa     Download sequence    Send to blast
MGITSTPPRP SIVTSHNSKG HINPTILHPQ LSKNPNSMSQ DYHHQSLFSF PNGFERSQVE  60
QQQQQQQQQQ QHMAQQIRRD KLRVQGFEPQ PFEEETSGLP VYDQTAGMLS EMFSFPPGTS  120
TELLEAQFNP NFRHPNPNQR SQPQQIPPPA GMGNEWFGNR QGMVVPLGYA KNHNNQISSA  180
SINAAESMQL FLMNPQPRSP SPSPSHPPPP PPPSTNSSTL HMLLPNPSST STIEGFPNPA  240
EGSFGQFTWG NNGGASASLN TPNEIGAGVN HVVESQGLSL SLSSSLQHKV EELRMGEESG  300
MLFFNQGGGG STTSGQFRYK NLNIGNSGVV GQNIHQQVHV GYGSSLGVVN VLRNSKYAKA  360
AQELLEEFCS VGRGKFKKNN KAAAANPNSN NPSGGTNGGG GNNNTSSSSS KDVPPLSAAD  420
RIEHQRRKVK LLSMLDEVDR RYNHYCEQMQ MVVNSFDLVM GFGAAIPYTA LAQKAMSRHF  480
RCLKDAITAQ LKHSCELLGD KDGGTSGLTK GETPRLKMLE QSLRQQRAFH QMGMMEQEAW  540
RPQRGLPERS VNILRAWLFE HFLHPYPSDA DKHLLARQTG LSRNQVSNWF INARVRLWKP  600
MVEEMYQQEA KEEEEEDDER ENSQNQNSGN NAQTPTPNMS NSSSTNMTTT TTALGAAAAA  660
ETGTAATTAT AASTLGKRSE INAPENDPSL VAINSHISFS ENQATFPTNI HDSDAAACHR  720
GGNFSGDDYG TTTNADVGST MIRFGTTAGD VSLTLGLRHA GNLPENTHFF G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16546604563Homeobox protein Meis2
3k2a_B2e-16546604563Homeobox protein Meis2
4xrm_A2e-16546604563Homeobox protein Meis2
4xrm_B2e-16546604563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4066990.0AF406699.1 Solanum tuberosum BEL1-related homeotic protein 13 (Bel13) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016477556.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ9SW801e-172BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLM1AMS70.0M1AMS7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000261720.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33412139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-140BEL1-like homeodomain 2