PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016477070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MIKC_MADS
Protein Properties Length: 225aa    MW: 25598.2 Da    PI: 9.0549
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016477070.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.61.6e-281059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    ri+n++ rqvtfskRrng+lKKA+EL +LCdaev +iifsstgklye+ss
  XP_016477070.1 10 RIDNTTSRQVTFSKRRNGLLKKAKELAILCDAEVGLIIFSSTGKLYEFSS 59
                    9***********************************************96 PP

2K-box83.16e-288317211100
           K-box  11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                      ++ + +q+e+a L+++++ Lq+++R+llGe+L+ Ls+k+L +Le+qLe slk +R++K+++l+++i+el +k + +++en +L kk+ e
  XP_016477070.1  83 MSEVKFWQREIASLRQQLHYLQENHRQLLGEELSGLSIKDLTNLENQLEMSLKGVRKQKEQILTDEIRELNQKGNLIHQENIELYKKVSE 172
                     57889*********************************************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.833161IPR002100Transcription factor, MADS-box
SMARTSM004325.2E-40160IPR002100Transcription factor, MADS-box
CDDcd002653.66E-44278No hitNo description
SuperFamilySSF554554.06E-33282IPR002100Transcription factor, MADS-box
PRINTSPR004049.6E-29323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.5E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004049.6E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004049.6E-293859IPR002100Transcription factor, MADS-box
PfamPF014862.6E-2684170IPR002487Transcription factor, K-box
PROSITE profilePS5129715.09386176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MGRGKIVIQR IDNTTSRQVT FSKRRNGLLK KAKELAILCD AEVGLIIFSS TGKLYEFSSN  60
SMRAIIDRYN EMKEEHHNLM SPMSEVKFWQ REIASLRQQL HYLQENHRQL LGEELSGLSI  120
KDLTNLENQL EMSLKGVRKQ KEQILTDEIR ELNQKGNLIH QENIELYKKV SEQGCGSEPN  180
GGVQATHAIS KGYDVHAPIS LQLSQPQTQK SVTSTSVMQL GLQLH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D8e-21276175MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C8e-21276175MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B8e-21276175MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A8e-21276175MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_S1e-20178178Myocyte-specific enhancer factor 2B
1tqe_R1e-20178178Myocyte-specific enhancer factor 2B
1tqe_Q1e-20178178Myocyte-specific enhancer factor 2B
1tqe_P1e-20178178Myocyte-specific enhancer factor 2B
3p57_J1e-20276175Myocyte-specific enhancer factor 2A
3p57_I1e-20276175Myocyte-specific enhancer factor 2A
3p57_D1e-20276175Myocyte-specific enhancer factor 2A
3p57_C1e-20276175Myocyte-specific enhancer factor 2A
3p57_B1e-20276175Myocyte-specific enhancer factor 2A
3p57_A1e-20276175Myocyte-specific enhancer factor 2A
3kov_J1e-20276175Myocyte-specific enhancer factor 2A
3kov_I1e-20276175Myocyte-specific enhancer factor 2A
3kov_B1e-20276175Myocyte-specific enhancer factor 2A
3kov_A1e-20276175Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3705280.0AY370528.1 Petunia x hybrida MADS-box protein 14 (PMADS14) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009612442.11e-165PREDICTED: MADS-box transcription factor 23-like isoform X2
RefseqXP_016477070.11e-165PREDICTED: MADS-box transcription factor 23-like isoform X2
SwissprotQ6EP492e-92MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLQ6UGQ71e-137Q6UGQ7_PETHY; MADS-box protein 14
STRINGGLYMA13G32810.11e-104(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.18e-93AGAMOUS-like 21