PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016476532.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 381aa    MW: 43302 Da    PI: 8.317
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016476532.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.89.6e-41152229178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +CqvegC++ l +ak yhrrhkvC +h+kap+v+v gleqrfCqqCsrfh +sefDe+krsCrrrLa+hnerrrk+++
  XP_016476532.1 152 RCQVEGCQVALVNAKAYHRRHKVCAMHAKAPKVVVLGLEQRFCQQCSRFHLVSEFDESKRSCRRRLAGHNERRRKSSQ 229
                     6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.6E-34147214IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.231150227IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.27E-38151233IPR004333Transcription factor, SBP-box
PfamPF031101.5E-31153226IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MENGGWNFFS NSIESCSSNN GGNGEQNSNS TPAWDFWQLG TTTSTSSQSQ LIQWNYNNSS  60
NIFNQDPITY TCPLNGSELI ARGVNKSREY FIQREKDHNL MCLNLNLGKR HCIENYEARP  120
HGGGEVVGFV MNKRKKHHFP GGDGAAEAVV PRCQVEGCQV ALVNAKAYHR RHKVCAMHAK  180
APKVVVLGLE QRFCQQCSRF HLVSEFDESK RSCRRRLAGH NERRRKSSQD HYTNTRNPSQ  240
AGNYRNLAVN EGRAHSLLSP KNDSWISKGN LPARCSATIN ELIAESRATR LDQQLIIDKD  300
WHRHQHYPME NLSIQLKNRS STDHNREHVV LKSNGWGRAN DAAGNLTLDF MHVRNSEFGF  360
LSEQEQLKEE GDEEGCPEHW N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-301532261184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016476532.10.0PREDICTED: squamosa promoter-binding-like protein 7 isoform X1
TrEMBLA0A1S4AIK90.0A0A1S4AIK9_TOBAC; squamosa promoter-binding-like protein 7 isoform X1
STRINGXP_009625590.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA134081417
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.12e-36squamosa promoter binding protein-like 3