PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016474877.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRF
Protein Properties Length: 328aa    MW: 37395.6 Da    PI: 9.2938
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016474877.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC789.4e-2573116144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e
  XP_016474877.1  73 DPEPGRCRRTDGKKWRCSKEAYADSKYCERHMHRGRNRSRKPVE 116
                     79***************************************997 PP

2QLQ60.93.5e-21943236
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                    +FTa+Q+q+L++Q+l+yKy+a+++PvPp+Ll  i+
  XP_016474877.1  9 PFTATQWQELEHQALIYKYMASGMPVPPDLLYTIR 43
                    9*****************************97776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.9E-12844IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.2E-16942IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.278944IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.65873117IPR014977WRC domain
PfamPF088795.6E-2174116IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MSRARSGYPF TATQWQELEH QALIYKYMAS GMPVPPDLLY TIRRSLDSSN LFLHQPQHIG  60
WNCIQLGFGK KIDPEPGRCR RTDGKKWRCS KEAYADSKYC ERHMHRGRNR SRKPVEVMTT  120
RTTTTTTTTM PPTAVPISSI KNNSNNYSPS TPASFPYSNE PQHSFLYPHS SSSRPPGNIG  180
LSSQDQTKFL FYSGAYSRSA SGSIDDSSWE LAPLTMGSPL GHSKQRTYSA SQIGESYLQL  240
QSFSESSKQQ QQRQDQYNYY ALGNDVKANM HMKIDTEDHQ QPKKVMHHFF DELPPDQHNK  300
DSWLDSKTHL SISVPDSSHD FFITHNGK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754464e-67HG975446.1 Solanum pennellii chromosome ch07, complete genome.
GenBankHG9755194e-67HG975519.1 Solanum lycopersicum chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009781044.10.0PREDICTED: growth-regulating factor 1-like
RefseqXP_016474877.10.0PREDICTED: growth-regulating factor 1-like
TrEMBLA0A1S4ADX40.0A0A1S4ADX4_TOBAC; growth-regulating factor 1-like
TrEMBLA0A1U7X2E10.0A0A1U7X2E1_NICSY; growth-regulating factor 1-like
STRINGXP_009781044.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7432384
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-54growth-regulating factor 5