PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016474509.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 997aa    MW: 110829 Da    PI: 6.0977
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016474509.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.99.2e-41142219178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqv++C +dls+ak+yhrrhkvCe+hska+ +lv +++qrfCqqCsrfh+l+efDe+krsCrrrLa+hn+rrrk+q+
  XP_016474509.1 142 VCQVDDCGTDLSKAKDYHRRHKVCEMHSKASRALVGNVMQRFCQQCSRFHALQEFDEGKRSCRRRLAGHNKRRRKTQS 219
                     6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.2E-33137204IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.086140217IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.72E-38141222IPR004333Transcription factor, SBP-box
PfamPF031107.8E-30143216IPR004333Transcription factor, SBP-box
SuperFamilySSF484033.32E-7770883IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.203.8E-5772884IPR020683Ankyrin repeat-containing domain
CDDcd002041.82E-6773883No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 997 aa     Download sequence    Send to blast
MEASVGERYY HMGGPDLRGL GKRSLEWDVT DWKWDGDLFI ATPLRQNPSN NYQSRQFFPV  60
ETGNLVASSN SSSSCSDETN HGIEQQRREL EKRRRVIVVD ENESGGTLSL KLGGQVEPVA  120
EKRTKLAAAQ PVTSTPTTTR AVCQVDDCGT DLSKAKDYHR RHKVCEMHSK ASRALVGNVM  180
QRFCQQCSRF HALQEFDEGK RSCRRRLAGH NKRRRKTQSE SVVNNNSSND GQASGYSLMS  240
LLKMLSNMHS NGTNHTEDQD LLAHLLRSIA GQGSLNGDKS LSGLLQESSS MLNNRSILRN  300
PELASLISNG SQVPPRAKEH QFTNSAAEIP QKRLDAHDVR LEDARTASSQ SPGILFPPTQ  360
SNSQAYAPGR GSTTGRSKLI DFDLNDVYVD SDDNVEDIDR SPGQCPSWLQ QDSHQSSPPQ  420
TSGNSDSASA QSPSSSSGDT QTRTDRIVFK LFGKDPSDFP FVVRAQILDW LSHSPTEIES  480
YIRPGCVVLT VYLRLPESAW EELCYDLNSS LSRLLDVHGD DSFWTKGWIY ISVQDQIAFV  540
CDGQVLLDMS LPSGSDEHST ILSVRPIAVP VSGRAQFLVK GYNLSKPSTR LLCALESNYL  600
VPEANNEVEE HVDGIDKDDN LQSLNFTCSV PAVSGRGFIE VEDHGLSNSF FPFIVAEEDV  660
CSEIRMLESE LDLTSANYVK GQINNMEARN QAMDFIHELG WLLHRNNLKA RLEHFGPDAV  720
LYPLKRFKWL IDFCVDHEWC AVVKKLLNVL LDGTVGAGDS SFLKFALTEM GLLHRAVRRN  780
SRPLVELLLT YTPEKVADEL SSEYQSLVGV DGEFLFRPDC VGPAGLTPLH VAAGIDGSED  840
VLDALTDDPG KVAIEAWKNT RDSTGFTPED YARLRGHYSY IHLVQRKISK KATSGHIVVD  900
IPIVPSVENS NQKEEFATTS LEISMTERRP ISRPCGLCHK KLAYGSRSRS LLYRPAMFSM  960
VAMAAVCVCV ALLFRGSPEV LYIFRPFRWE MVDFGTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-31134216284squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19195KRRRV
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Binds specifically to the 5'-GTAC-3' core sequence. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16095614}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00603PBMTransfer from AT2G47070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016474509.10.0PREDICTED: squamosa promoter-binding-like protein 1 isoform X2
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLA0A1S4AD260.0A0A1S4AD26_TOBAC; squamosa promoter-binding-like protein 1 isoform X2
STRINGXP_009592086.10.0(Nicotiana tomentosiformis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Chao LM, et al.
    Arabidopsis Transcription Factors SPL1 and SPL12 Confer Plant Thermotolerance at Reproductive Stage.
    Mol Plant, 2017. 10(5): p. 735-748
    [PMID:28400323]