PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016474071.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 312aa    MW: 36145.1 Da    PI: 4.6491
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016474071.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox52.77.4e-1790142456
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     + ++ ++q++ L + Fe ++++  e++ +LAk++gL+ rqV +WFqNrRa++k
  XP_016474071.1  90 KSRLLPKQVQFLAKSFEVENKLEPERKIQLAKEIGLQPRQVAIWFQNRRARYK 142
                     5566789*********************************************9 PP

2HD-ZIP_I/II118.82.9e-3888179192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     ekk rl  +qv++L +sFe e+kLeperK +la+e+glqprqva+WFqnrRAR+k+kqlEkdy++Lk+++d+lk+e ++L ke+e+Lr+e++
  XP_016474071.1  88 EKKSRLLPKQVQFLAKSFEVENKLEPERKIQLAKEIGLQPRQVAIWFQNRRARYKSKQLEKDYDVLKASFDKLKDEYDSLFKENENLRNEVH 179
                     69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.19684144IPR001356Homeobox domain
SMARTSM003891.0E-1586148IPR001356Homeobox domain
CDDcd000861.40E-1489145No hitNo description
SuperFamilySSF466891.71E-1689154IPR009057Homeodomain-like
PfamPF000463.0E-1490142IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.0E-1892151IPR009057Homeodomain-like
PRINTSPR000311.7E-5115124IPR000047Helix-turn-helix motif
PROSITE patternPS000270119142IPR017970Homeobox, conserved site
PRINTSPR000311.7E-5124140IPR000047Helix-turn-helix motif
PfamPF021832.7E-17144185IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MEVARVYEGS NVNSHNGFIL PNEIFPPPSK VLDSLWISNS SPTFHGSVSM VNFNDTRGKK  60
TKERSFFPSL DKEENSNEDY QVSFHQPEKK SRLLPKQVQF LAKSFEVENK LEPERKIQLA  120
KEIGLQPRQV AIWFQNRRAR YKSKQLEKDY DVLKASFDKL KDEYDSLFKE NENLRNEVHL  180
LKEKLFDRVN GEQNSEQKEP ISPLNTEAQN STTNMQNLTM MVCKQEDASS AKSDILDSDS  240
PCYADENYTS FLEPTDSSHV FETETSNFSQ EDDSLCWSLL PSLCFPKLED DLPVNSCNLS  300
FQIEDQSWFC HY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136144RRARYKSKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009594284.10.0PREDICTED: homeobox-leucine zipper protein ATHB-54-like
RefseqXP_016474071.10.0PREDICTED: homeobox-leucine zipper protein ATHB-54-like
TrEMBLA0A1S4ABT70.0A0A1S4ABT7_TOBAC; homeobox-leucine zipper protein ATHB-54-like
STRINGXP_009594284.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8252495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.12e-44homeobox 1