PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016473165.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRF
Protein Properties Length: 415aa    MW: 46026.5 Da    PI: 8.9189
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016473165.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC695.9e-22114157145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRC+r+v++g+k+C  H+hrg  rsrk +e+
  XP_016473165.1 114 DPEPGRCRRTDGKKWRCKRDVIPGQKYCGQHMHRG-RRSRKLVEA 157
                     79*********************************.688888876 PP

2WRC61.61.3e-19302337237
             WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrs 37 
                     +ep rCrR+DGKkWRCsr++++ +k+CE H+hrg +
  XP_016473165.1 302 TEPQRCRRSDGKKWRCSRNAVPRQKYCETHMHRGAK 337
                     79*******************************976 PP

3QLQ39.61.6e-145086137
             QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                    s FT  Q+++L  Q+ ++Ky+++++PvP +L + i++
  XP_016473165.1 50 SVFTTVQFHELQLQAVIFKYIVSGLPVPFHLFFTIWN 86
                    67*****************************999997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.9E-65086IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166616.2815186IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.3E-105285IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166722.778114160IPR014977WRC domain
PfamPF088793.8E-18115152IPR014977WRC domain
PROSITE profilePS5166720.453301345IPR014977WRC domain
PfamPF088793.2E-17303338IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MQPHLSSATP LSHSGKDERE KNEGSPPCIK LSLGYVVEEE EKGVNAIAKS VFTTVQFHEL  60
QLQAVIFKYI VSGLPVPFHL FFTIWNTVSS SLGSAVINKL YPTLGRFDYA SMMDPEPGRC  120
RRTDGKKWRC KRDVIPGQKY CGQHMHRGRR SRKLVEASEH VMKSDDICIT PKRTKLYANS  180
DDPGSKCAPA SSKTSCLSST SRNNQNNSVE DSSAKPRPTN SCNSSEKLDN HMTFNRKDTT  240
TCIRTQSFIA GNDTDSKSID FNHISPSKTN QKQSYGDARN SGGLAPVFGI SAKIDLQHTT  300
ETEPQRCRRS DGKKWRCSRN AVPRQKYCET HMHRGAKKIM AASDSVIVEP SKPSSYRFCH  360
QVIPKNDGTG INLNTSLSIS TLPDPQNITE DDDSNSNSTS DATTITDEIP AFVSH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009800682.10.0PREDICTED: growth-regulating factor 9 isoform X2
RefseqXP_016473165.10.0PREDICTED: growth-regulating factor 9-like isoform X2
TrEMBLA0A1S4A9480.0A0A1S4A948_TOBAC; growth-regulating factor 9-like isoform X2
TrEMBLA0A1U7Y9880.0A0A1U7Y988_NICSY; growth-regulating factor 9 isoform X2
STRINGXP_009800681.10.0(Nicotiana sylvestris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45480.13e-34growth-regulating factor 9