PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016472877.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 146aa    MW: 16476.7 Da    PI: 7.7657
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016472877.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601231.5e-3851051101
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk lrr+C++dC++ pyfp ++p++f +vh+++Gasnv k+l++++e++r d++ +l+yeA +r++dPvyG+vg+++ l++++ ql++++a
  XP_016472877.1   5 RCAACKQLRRRCPSDCIFLPYFPPNNPQRFSCVHRIYGASNVGKMLQQVQEHQRADVAGTLYYEAYCRIKDPVYGCVGIVTVLHEEIYQLQSQMA 99 
                     6********************************************************************************************** PP

          DUF260  96 llkeel 101
                     ++++e+
  XP_016472877.1 100 KVQAEI 105
                     *99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.0284105IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-385102IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MTSTRCAACK QLRRRCPSDC IFLPYFPPNN PQRFSCVHRI YGASNVGKML QQVQEHQRAD  60
VAGTLYYEAY CRIKDPVYGC VGIVTVLHEE IYQLQSQMAK VQAEIDLHKA QSPVQGQQQV  120
EFSANSLADQ NGVYTSSPSL FDPSFH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-36610512111LOB family transfactor Ramosa2.1
5ly0_B4e-36610512111LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754409e-51HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016472877.11e-106PREDICTED: LOB domain-containing protein 24-like
SwissprotP594683e-47LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A1S4A8A91e-105A0A1S4A8A9_TOBAC; LOB domain-containing protein 24-like
STRINGXP_009780781.11e-105(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52772039
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.11e-49LOB domain-containing protein 24