PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016470159.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 593aa    MW: 66954.1 Da    PI: 5.013
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016470159.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS295.71.2e-902215911374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.....sseelaalklfsevsPi 90 
                     lv+lLl++Ae v++++++la++l++r    as++g+p+qRl +yf++ L++r+ rs+ +   + + ++    +        + +a+ + +++ P+
  XP_016470159.1 221 LVHLLLAAAEEVNNQQFHLASKLISRCMWVASESGNPVQRLSFYFAKSLEERIDRSTGRYTCTDEDRHL---KciktmALGTNSAFLTCHQLLPF 312
                     68*****************************************************43332222222222...122222333444555689***** PP

            GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak 184
                      ++ +++  q+Ile v++++++H iDf+i  G+QW  L+qaLa++  ++   l+iT+vgs   ++ke+ e tg+ L++fA++lgvpf+f+v+  +
  XP_016470159.1 313 SQVMQFAGIQTILEHVKSAKKIHLIDFNIRSGIQWTVLMQALAEKGdSPIKLLKITAVGS---TEKEKFEVTGNTLHSFAKSLGVPFSFDVVFLS 404
                     ********************************************984455599*******...579***************************** PP

            GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                     +++d++ e+ +++ +E++aV +   l ++  ++ +le+    ++k+v+s+ P+v+v+ e ea+hns+sFl+rf+e+l +y a+fd++e  + r+s
  XP_016470159.1 405 DMKDFKKESVNIEADETVAVYCNTVLRTMIPKPDCLEN----LMKVVRSIGPTVIVIGEVEANHNSPSFLNRFIETLFFYGAFFDCFEDCMDRDS 495
                     ******************************99999999....***************************************************** PP

            GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaW 373
                       r+++E +++g+ i+n+va+eg+er+ r+ +l+ Wr+ + + G+ + +lse+a  qa+l+++k++ +   +++++ + l++gWk+ p+ s+S W
  XP_016470159.1 496 PCRRTIEGVYFGEGIRNIVAAEGKERFTRNVKLQVWRAFFARLGMVEEELSESAWYQANLIVKKFAqGSCCNLHKDGKGLIIGWKGTPIHSLSIW 590
                     ******************************************************************77779************************ PP

            GRAS 374 r 374
                     +
  XP_016470159.1 591 K 591
                     8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.226195570IPR005202Transcription factor GRAS
PfamPF035144.1E-88221591IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 593 aa     Download sequence    Send to blast
MVICPGIGTM ANVSISNDNF TDFQGDHLKG YERNELVING VEDPWFELED CTDIDSVYSI  60
CGLINEENTS NEQVTTNLLE DQQQSISNWM QSQFSNNTDQ IKSSIEAPKD DDFQPQVLEL  120
IGHSSSEKPN PFSLASFELL NNYGRLIKKS SEENLNISNA LSYEARACNN HKLSMEEILM  180
VAGERYIQYS TQRLDGLSMF IHPYGSALSG LSIEETRDME LVHLLLAAAE EVNNQQFHLA  240
SKLISRCMWV ASESGNPVQR LSFYFAKSLE ERIDRSTGRY TCTDEDRHLK CIKTMALGTN  300
SAFLTCHQLL PFSQVMQFAG IQTILEHVKS AKKIHLIDFN IRSGIQWTVL MQALAEKGDS  360
PIKLLKITAV GSTEKEKFEV TGNTLHSFAK SLGVPFSFDV VFLSDMKDFK KESVNIEADE  420
TVAVYCNTVL RTMIPKPDCL ENLMKVVRSI GPTVIVIGEV EANHNSPSFL NRFIETLFFY  480
GAFFDCFEDC MDRDSPCRRT IEGVYFGEGI RNIVAAEGKE RFTRNVKLQV WRAFFARLGM  540
VEEELSESAW YQANLIVKKF AQGSCCNLHK DGKGLIIGWK GTPIHSLSIW KFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-4423959121375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2389180.0AC238918.11 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-210f9 map 1, complete sequence.
GenBankHG9755130.0HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016470159.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A1S4A0M90.0A0A1S4A0M9_TOBAC; DELLA protein RGL1-like
STRINGXP_009628660.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.17e-50RGA-like 2