PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016467487.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family G2-like
Protein Properties Length: 401aa    MW: 46708.1 Da    PI: 9.5135
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016467487.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.8e-3299152255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     prlrWtpeLH++Fv+a+e+LGG+e+AtPk +l+lm+v gL+++hvkSHLQ+YR+
  XP_016467487.1  99 PRLRWTPELHRSFVHAIERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRS 152
                     8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.09495155IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-3095153IPR009057Homeodomain-like
SuperFamilySSF466893.23E-1597153IPR009057Homeodomain-like
TIGRFAMsTIGR015575.9E-2399154IPR006447Myb domain, plants
PfamPF002491.5E-8100151IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MTENSMKQAN EEMMTNTMEY IMEKTSSDSS SQSKLVSFVD LNEDNKGESD EEEEVIEISV  60
ENSNEKTTDE GNSENNNNSS GNGRVEKKNV RHYVRSKMPR LRWTPELHRS FVHAIERLGG  120
QERATPKLVL QLMNVRGLSI AHVKSHLQMY RSKKLDESGQ VLGRNYRAMQ GRSYFYGNVG  180
QRYNPRQDFK MKNGAIVLAR NFNYDHDHVK GHFRNSFSRP PYQAKDIFSR YLQWSSNQGS  240
VLNTTREKLC TPRQFQKNGG HEIGPVRSSQ FLEEKRWPPS EFTANQLEEK IADFSNICSA  300
KNSQYLLQQN VAQPYSKWNC RYNTLEQNLE TPTRLEMKED KSFMTGKDWL PDLQLRLSRS  360
TENKNEKNTH HHSKRMDHQS EINTMLSLSL PTYSLSEPKR K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-17100154357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-17100154357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-17100154357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-17100154357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016467487.10.0PREDICTED: uncharacterized protein LOC107790101
RefseqXP_016467488.10.0PREDICTED: uncharacterized protein LOC107790101
RefseqXP_016467489.10.0PREDICTED: uncharacterized protein LOC107790101
RefseqXP_016467491.10.0PREDICTED: uncharacterized protein LOC107790101
RefseqXP_016467492.10.0PREDICTED: uncharacterized protein LOC107790101
RefseqXP_016467493.10.0PREDICTED: uncharacterized protein LOC107790101
TrEMBLA0A1S3ZT670.0A0A1S3ZT67_TOBAC; uncharacterized protein LOC107790101
STRINGXP_009802187.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55162334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.16e-36G2-like family protein