PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016466919.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 960aa    MW: 107364 Da    PI: 6.3525
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016466919.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.31.6e-41110187178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqv+gC +dls+ak+yhrrhkvCe+hsk++ +lvs+l+qrfCqqCsrfh+l+efDe+krsCrrrLa+hn+rrrk+qa
  XP_016466919.1 110 VCQVDGCGVDLSNAKDYHRRHKVCEMHSKSSRALVSNLMQRFCQQCSRFHALEEFDEGKRSCRRRLAGHNKRRRKTQA 187
                     6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.7E-33105172IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.59108185IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.53E-38109188IPR004333Transcription factor, SBP-box
PfamPF031102.1E-30111184IPR004333Transcription factor, SBP-box
SuperFamilySSF484039.02E-8735854IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.202.3E-5742854IPR020683Ankyrin repeat-containing domain
CDDcd002043.20E-7743853No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 960 aa     Download sequence    Send to blast
MEARMGGEVQ LFKKSLEWDP NDWKWDGDLF IAKPKIPSSN YQFFPLETGN SSSSCSDEVN  60
LGEFEKRRRE NDENVEYDSA SLSLKLGEQR GHPREFGKRT KLTTTSSRAV CQVDGCGVDL  120
SNAKDYHRRH KVCEMHSKSS RALVSNLMQR FCQQCSRFHA LEEFDEGKRS CRRRLAGHNK  180
RRRKTQADSD DNSKTLNDVQ TSGYSLISLL KILSNMHSNR TNHIEDQDLL SHLLRSLASQ  240
GVPNGDNNLS GLLQASSNLL SNRSPSRNSD IVSLVSNGSQ GPPILKEQHF ATLAAQAPQR  300
SSDVHDVRLE DVRTESCRSP GTSFPNQNSS PAYAQARKSS AGRSKLINFD LNDVYDGSDD  360
GGENLDRSPL PADRGIGPLE CRSWLQQDSH QSSPPSRNSD SASTQSPSSS SSDAQSRTDR  420
IVFKLFGKDP SDFPYVLRAQ ILDWLSHSPT EIESYIRPGC IVLTVYLRLP ESAWEELCCD  480
LSSSLSRLLD VPDDSFWRKG WIYIRVQNQI AFVHDGKLLL DVPLPSETIE HTSILSVKPI  540
AVPVSDRAQF IVKGYNLTKP STRLLCALEG NYLVTEANDE VEHVDGVNKY AKLQLMDLTC  600
SIPAVSGRGF IEVEDHGLSN GFFPIIIAEE DVCSEIRMLE SAIELTSAEN VNGLTNNMEV  660
KSQAMDFIHE MGWLLHRNNL KARLGNSNAV LFPLKRFKWL MEFSIDHDWC AVVRKLLNLL  720
LDGTVGGEEN SFLKVSLSEM GLLHKAVRRN SKPLVELLLT YTPNEVADEL CSEYQSLVGV  780
DGKFLFRPDS VGPAGLTPLH VAAGIDGYED VLDALTDDPG MVAVEAWKNT RDSAGFTPED  840
YARLRGHYSY IHLVQRKINR VTTKHIVVDI PNIMSGGNSN QKDECEVSQT ERRLIQPCGM  900
CDRKLGYGSR SRSLLYRPVM FSMVALAAVC VCVALLFKSS PEVLYIFRPF RWEMLEYGSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-311101841084squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Binds specifically to the 5'-GTAC-3' core sequence. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16095614}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016466919.10.0PREDICTED: squamosa promoter-binding-like protein 1
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLA0A1S3ZRI10.0A0A1S3ZRI1_TOBAC; squamosa promoter-binding-like protein 1
STRINGXP_009617528.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18712466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Chao LM, et al.
    Arabidopsis Transcription Factors SPL1 and SPL12 Confer Plant Thermotolerance at Reproductive Stage.
    Mol Plant, 2017. 10(5): p. 735-748
    [PMID:28400323]