PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016466876.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 171aa    MW: 19316.3 Da    PI: 9.5581
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016466876.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.43.1e-4150127178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cq+++C++dls+ak+yh+rhkvCe h+ka++v+v+gl+qrfCqqCsrfhe+ efDe+krsCrrrLa+hnerrrk+++
  XP_016466876.1  50 CCQADKCTVDLSDAKQYHKRHKVCEYHAKAQAVVVAGLRQRFCQQCSRFHEVGEFDESKRSCRRRLAGHNERRRKTTT 127
                     6**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.4E-3244112IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.70148125IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.08E-3749128IPR004333Transcription factor, SBP-box
PfamPF031108.6E-3251124IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MEAADNNDLF IFATDNDDKK KRTPSYNNRS SSSSNNNNEK IKGSSTSMRC CQADKCTVDL  60
SDAKQYHKRH KVCEYHAKAQ AVVVAGLRQR FCQQCSRFHE VGEFDESKRS CRRRLAGHNE  120
RRRKTTTTSS SSDQSNAEVS SSRKAIIGTD THQIINFQEN AAAGYKHFQI G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-3845124584squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156. {ECO:0000269|PubMed:16914499}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2606352e-76KP260635.1 Nicotiana tabacum SBP-box 4 (SPL4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016466876.11e-124PREDICTED: squamosa promoter-binding-like protein 3
SwissprotQ9S7581e-41SPL5_ARATH; Squamosa promoter-binding-like protein 5
TrEMBLA0A1S3ZR671e-123A0A1S3ZR67_TOBAC; squamosa promoter-binding-like protein 3
STRINGXP_009620386.11e-104(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74924105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.15e-43squamosa promoter binding protein-like 5
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Xu M, et al.
    Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana.
    PLoS Genet., 2016. 12(8): p. e1006263
    [PMID:27541584]
  3. Ioannidi E, et al.
    Trichome patterning control involves TTG1 interaction with SPL transcription factors.
    Plant Mol. Biol., 2016. 92(6): p. 675-687
    [PMID:27631431]
  4. Jung JH,Lee HJ,Ryu JY,Park CM
    SPL3/4/5 Integrate Developmental Aging and Photoperiodic Signals into the FT-FD Module in Arabidopsis Flowering.
    Mol Plant, 2016. 9(12): p. 1647-1659
    [PMID:27815142]