PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016466740.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 640aa    MW: 72215.4 Da    PI: 6.8192
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016466740.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.17.1e-093934301954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  XP_016466740.1 393 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 430
                     554459******************************88 PP

2BELL114.55.4e-37256324472
            BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     elqk+k+kLl++leeVd+rYk+y++q+++v+s Feavag g+a++Y +lA+ka+SrhFrcL+d i++qi
  XP_016466740.1 256 ELQKRKTKLLQMLEEVDRRYKHYCDQMKAVVSTFEAVAGNGAARVYSTLASKAMSRHFRCLRDGIVGQI 324
                     89*****************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.0E-55190322IPR006563POX domain
PfamPF075261.1E-45196320IPR006563POX domain
PROSITE profilePS5007112.082371434IPR001356Homeobox domain
SMARTSM003895.8E-9374438IPR001356Homeobox domain
CDDcd000865.79E-11374435No hitNo description
SuperFamilySSF466895.13E-17375440IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-27377440IPR009057Homeodomain-like
PfamPF059208.5E-18391430IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 640 aa     Download sequence    Send to blast
MAGQESEEIK PRSMVTSTGY WYSDHTSTPS NIPNLVNHQL QSFETNPEIY NLTSGMEMIG  60
FPTNNPQVMW KGNFFNKTGG NSTGPSSSKS TNEQFYQHGN FTTSENMLLV SPTEDQAWHE  120
NNRLLVEDPS LRCVFPCEGN ERPSQGLSLS LCSSNPSSIG LQSFELRHQQ QIIQDGFLGK  180
AAANIQQQNQ GYYHQIKDSR YLGPAQELLV EFCSLGTKQN DHSSAKVLKQ QKSNQWEDEN  240
ASTSKKQTLQ SLDLLELQKR KTKLLQMLEE VDRRYKHYCD QMKAVVSTFE AVAGNGAARV  300
YSTLASKAMS RHFRCLRDGI VGQIKATKKA MGEKDTVVVP GTTRGETPRL RLLDQTLRQQ  360
KAFQQMNMME THPWRPQRGL PERSVSVLRA WLFEHFLHPY PSDVDKHILA RQTGLSRSQV  420
SNWFINARVR LWKPMVEEMY LEETKDQQEN LESPDGSKGL DHDMNGISVG RQINQNPQLH  480
IEDQKPNLVR IDSECISSII NHPEKNDTTN NNNKNCLQNH HQVHNLHSFG RGGDHSFGAI  540
ELDFSSYNHN STGAIAYGNE SVQHNIGRGV SLTLGLNQNG GSGMGLSTFS QASQSSLFYP  600
RDDHIDQDCQ QVQYSLLDSE NQNLPYRNLM GAQLLHDLAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-15380438563Homeobox protein Meis2
3k2a_B2e-15380438563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4067000.0AF406700.1 Solanum tuberosum BEL1-related homeotic protein 14 (Bel14) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016466740.10.0PREDICTED: homeobox protein BEL1 homolog
RefseqXP_016466741.10.0PREDICTED: homeobox protein BEL1 homolog
RefseqXP_016466742.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-138BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLM1AWW90.0M1AWW9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000321220.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53001317
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-124TALE family protein