PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016465678.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MIKC_MADS
Protein Properties Length: 342aa    MW: 39145 Da    PI: 5.4498
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016465678.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.12.3e-28958150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    k+ien++nrqvtfskRrng++KKA+ELSvLCd++va+i+fs++g++ ++s
  XP_016465678.1  9 KKIENTTNRQVTFSKRRNGLIKKAYELSVLCDVDVALIMFSPSGRISTFS 58
                    68***********************************************8 PP

2K-box19.54e-08102172171
           K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKne 71 
                     yq++s+ +  +++ e+ qqe+ k k ++e + r +R + G+  e  ++ e q  e+ L++ lk++ ++K+ 
  XP_016465678.1 102 YQAASSPASVDSQIEEFQQEILKYKTQLEDMDRRLRMYEGDLCEITTVCEAQYREEILQETLKQVQARKHV 172
                     6667777788999*******************************************************974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.885161IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-37160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-30282IPR002100Transcription factor, MADS-box
CDDcd002651.66E-38275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-25323IPR002100Transcription factor, MADS-box
PfamPF003191.3E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-253859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGRVKLQIKK IENTTNRQVT FSKRRNGLIK KAYELSVLCD VDVALIMFSP SGRISTFSGN  60
KSIEDIMARY VNLPEHDRGR LHNQEHLQRA IAKLKCETDR TYQAASSPAS VDSQIEEFQQ  120
EILKYKTQLE DMDRRLRMYE GDLCEITTVC EAQYREEILQ ETLKQVQARK HVLEETYSSP  180
QRQTAPQPQM DFASQNVNVV NNVATSDSIP NTSSNTFMDW VPRSQRDPHV QILNFLDSNG  240
LLPFRDEADQ RMENMLPPSL TQLHTPNVSA VVTDHLSPPN NRFENDPPRP TSSFEGIIDV  300
NNAPWPPLYP TGNDPFPEAQ PRERALLELF LSQLTPVNQD HL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P7e-16189190Myocyte-specific enhancer factor 2B
1tqe_Q7e-16189190Myocyte-specific enhancer factor 2B
1tqe_R7e-16189190Myocyte-specific enhancer factor 2B
1tqe_S7e-16189190Myocyte-specific enhancer factor 2B
3mu6_A5e-16270168Myocyte-specific enhancer factor 2A
3mu6_B5e-16270168Myocyte-specific enhancer factor 2A
3mu6_C5e-16270168Myocyte-specific enhancer factor 2A
3mu6_D5e-16270168Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754433e-74HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009629660.10.0PREDICTED: agamous-like MADS-box protein AGL8 homolog isoform X1
RefseqXP_016465678.10.0PREDICTED: agamous-like MADS-box protein AGL66 isoform X1
SwissprotQ9LM464e-52AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBLK4BUR70.0K4BUR7_SOLLC; Uncharacterized protein
STRINGSolyc04g078300.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61831925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.12e-53AGAMOUS-like 104