PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016464746.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 163aa    MW: 18462 Da    PI: 7.7665
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016464746.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260110.89.6e-35101101101
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaC +  + C ++C+lapyfpa+qpk+f+nv +lFG+s++l++l++l+ +e++ am+s++yeA+ar++ PvyG+v+ i++l  +++  ++el+
  XP_016464746.1  10 ACAACNYGMKPCDPHCPLAPYFPADQPKTFQNVYRLFGVSKILQMLHQLDATEKKPAMQSIIYEANARQKHPVYGCVAEIRNLYFNIRLCEQELQ 104
                     7********************************************************************************************** PP

          DUF260  96 llkeel 101
                     +++e+l
  XP_016464746.1 105 KVREQL 110
                     *99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.479110IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-3210107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MDLTNVTNQA CAACNYGMKP CDPHCPLAPY FPADQPKTFQ NVYRLFGVSK ILQMLHQLDA  60
TEKKPAMQSI IYEANARQKH PVYGCVAEIR NLYFNIRLCE QELQKVREQL SLYTKQLENS  120
SSTPGDSVSQ IRSENIIPPS TCGNTLSLFT QDTHGRLQVQ NQH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-221111412115LOB family transfactor Ramosa2.1
5ly0_B1e-221111412115LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009803696.11e-120PREDICTED: LOB domain-containing protein 27-like isoform X2
RefseqXP_016464746.11e-120PREDICTED: LOB domain-containing protein 27-like
SwissprotQ9STS67e-34LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A1S3ZK391e-119A0A1S3ZK39_TOBAC; LOB domain-containing protein 27-like
TrEMBLA0A1U7YNY11e-119A0A1U7YNY1_NICSY; LOB domain-containing protein 27-like isoform X2
STRINGXP_009803689.11e-116(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14492375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.13e-36LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]