PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016464357.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 328aa    MW: 37084.6 Da    PI: 6.0577
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016464357.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.45.7e-39621611100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rrkCa+dCvlapyfp++++++f n+hklFG+sn++k++++l++  +++am+++++++++ra+dPv G++++i++lq++++  kael+
  XP_016464357.1  62 ACAACKYQRRKCAPDCVLAPYFPHDRQRQFLNAHKLFGVSNITKIIRHLDQPLKDEAMRTIIFQSDVRANDPVGGCYRIIRDLQRHIDYCKAELD 156
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                      + ++
  XP_016464357.1 157 IVLHQ 161
                     88776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.19861162IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-3662157IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MQNQITTIST SIPNHHHTTH TTFATANNLN HNYSTKRVNN NNNNNNNNNK NVLLRVNGTG  60
QACAACKYQR RKCAPDCVLA PYFPHDRQRQ FLNAHKLFGV SNITKIIRHL DQPLKDEAMR  120
TIIFQSDVRA NDPVGGCYRI IRDLQRHIDY CKAELDIVLH QLAYCRAQAV AAAAAASEQQ  180
ILADHHATEE SFNENNCDGV VNQADPLVNN NASSYDQQTI DYHPHSYYNH TSCQQGEDDQ  240
QYDEIQDGQL DLADINFPWS LHEQESTSTS TPNSLMKQLS VHEQCDNIKP ILEGITGFGE  300
EGLSFEHDQA FDQHSYSTRE HSPIEGRG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-26581567105LOB family transfactor Ramosa2.1
5ly0_B2e-26581567105LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016464357.10.0PREDICTED: LOB domain-containing protein 22-like
TrEMBLA0A1S3ZJ770.0A0A1S3ZJ77_TOBAC; LOB domain-containing protein 22-like
STRINGXP_009789767.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA99262126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-52LOB domain-containing protein 22