PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016463368.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 225aa    MW: 24631 Da    PI: 8.1916
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016463368.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.22.1e-41451441100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l +++e++r d+++slvyeA++r+rdPvyG++g i++lqqq++ l+ el+
  XP_016463368.1  45 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVSENQRADTANSLVYEANVRLRDPVYGCMGAISALQQQVQALQMELN 139
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_016463368.1 140 VVRAE 144
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.19944145IPR004883Lateral organ boundaries, LOB
PfamPF031953.2E-4145142IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MSRERERYEE IGKKIKREAD DYSQMGRRYL LGNPGTTTTL NTVTPCAACK LLRRRCAQEC  60
PFSPYFSPHE PQKFASVHKV FGASNVSKML MEVSENQRAD TANSLVYEAN VRLRDPVYGC  120
MGAISALQQQ VQALQMELNV VRAEILKYKF GDTTTLTNLP SSHISSLLAS GAVSVVAALP  180
PPPPPPPPLS LPSTISSSSD AMYAQPSTTS EFSTISSENN ISYFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-45381604127LOB family transfactor Ramosa2.1
5ly0_B2e-45381604127LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754451e-100HG975445.1 Solanum pennellii chromosome ch06, complete genome.
GenBankHG9755181e-100HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009591808.11e-167PREDICTED: LOB domain-containing protein 15
RefseqXP_016463368.11e-167PREDICTED: LOB domain-containing protein 15-like
SwissprotQ8L5T57e-84LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A1S3ZFY91e-165A0A1S3ZFY9_TOBAC; LOB domain-containing protein 15-like
STRINGXP_009591808.11e-166(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.17e-71LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]